Munich full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „Personalsachbearbeiter (m/w/d) - Zeitwirtschaft“ in Teilzeit. Aufgaben Als Sachbearbeiter Zeitwirtschaft (m/w/d) betreuen Sie die Arbeitszeiterfassung und pflegen Arbeitszeitmodelle sowie individuelle Sollzeiten Sie bearbeiten Zeitbuchungen, Abwesenheiten und Urlaubskonten und führen Korrekturen im System durch Zudem unterstützen Sie die Entgeltabrechnung durch vorbereitende Tätigkeiten wie Stunde...
Duisburg 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Duisburg suchen wir Sie zum nächstmöglichen Zeitpunkt als „Projektplanner (m/w/d)“. Aufgaben Als Projektplaner (m/w/d) erstellen und steuern Sie Projektstruktur- und Terminpläne für komplexe Anlagenbau- und Energieprojekte Sie koordinieren Fachbereiche, analysieren kritische Pfade und Pufferzeiten und sichern eine realistische Terminplanung Zudem entwickeln und optimieren Sie Terminsteuerungsprozesse entlang des gesamten Projektverlaufs Darüber hinaus er...
Duisburg 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Duisburg suchen wir Sie zum nächstmöglichen Zeitpunkt als „Planungskoordinator (m/w/d)“. Aufgaben Als Planungskoordinator (m/w/d) erstellen, pflegen und steuern Sie eigenständig Projektstrukturpläne sowie Zeitpläne für komplexe Anlagenbauprojekte Desweitren koordinieren und integrieren Sie alle relevanten Fachdisziplinen und analysieren kritische Pfade sowie Pufferzeiten für einen reibungslosen Projektablauf Des Weiteren entwickeln und optimieren Sie Ter...
Dresden full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Dresden suchen wir Sie zum nächstmöglichen Zeitpunkt als „Fachkraft für Arbeitssicherheit / Sicherheitsingenieur (m/w/d)“. Aufgaben Als Fachkraft für Arbeitssicherheit / Sicherheitsingenieur (m/w/d) übernehmen Sie die Planung, Umsetzung und Weiterentwicklung von Maßnahmen zur Förderung von Sicherheit, Gesundheit und Compliance im Unternehmen Sie identifizieren Optimierungspotenziale und führen effiziente, automatisierte Lösungen zur Verbesserung von Proz...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „LSA Engineer (m/w/d) – Logistic Support Analysis“. Aufgaben Als LSA Engineer (m/w/d) erstellen Sie Logistic Support Analysen (LSA) für komplexe Systeme und Komponenten Sie strukturieren logistische Daten und entwickeln Wartungs- und Instandhaltungskonzepte entlang des Produktlebenszyklus Zudem erstellen Sie Gerätestrukturen sowie Analysen wie FMEA, RCM und Maintenance Task Analysis (MTA) Darüber h...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „Controller (m/w/d) mit Projekterfahrung “. Aufgaben Als Controller (m/w/d) verantworten Sie das Controlling mit Fokus auf Kosten- und Leistungsrechnung Sie unterstützen bei der Erstellung von Wirtschaftsplänen, Forecasts und Rentabilitätsanalysen Zudem analysieren Sie Kennzahlen, erstellen Reports und bereiten Ergebnisse adressatengerecht für das Management auf Darüber hinaus entwickeln und optimi...
Minden 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Minden suchen wir Sie zum nächstmöglichen Zeitpunkt als „Bauingenieur (m/w/d) - Projektmanagement & Bauüberwachung“. Aufgaben Als Bauingenieur (m/w/d) planen und steuern Sie Infrastruktur- und Bauprojekte von der Konzeptphase bis zur Umsetzung Sie übernehmen die Projektbearbeitung sowie die örtliche Bauüberwachung und stellen die Einhaltung von Qualität, Kosten und Terminen sicher Zudem arbeiten Sie sich in Neubau- und Sanierungsprojekte ein und unterstü...
Munich 34m ago
Show description
Im Auftrag unser Partnerunternehmen aus München suchen wir Sie als System Safety Engineer (m/w/d). Aufgaben Als System Safety Engineer (m/w/d) steuern und überwachen Sie die sicherheitstechnische Entwicklung komplexer Systeme über den gesamten Projektzyklus – von der Angebotsphase bis zur Kundenabnahme Sie koordinieren technische Abstimmungen mit internen Fachbereichen und führen Sicherheitsanalysen wie Hazard Analysis, FMEA, FMEDA und Fault Tree Analysis (FTA) durch Zudem verantworten Sie die s...
Augsburg 34m ago
Show description
Im Auftrag unser Partnerunternehmen aus dem Öffentlichen Dienst in Augsburg suchen wir Sie als IT Support Mitarbeiter (m/w/d)****. Aufgaben Als Mitarbeiter im Mitarbeiter im IT-Support (m/w/d) bearbeiten Sie eingehende Telefonanfragen im Service Desk und dokumentieren alle Anliegen strukturiert im Ticketsystem Sie unterstützen bei technischen Themen wie Telematikinfrastruktur, sicherer Online-Anbindung sowie digitalen Services und Benutzerzugängen Zudem beraten Sie Anwender bei der elektronische...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „ Sachbearbeiter Forderungsmanagement (m/w/d) “. Aufgaben Als Sachbearbeiter Forderungsmanagement (m/w/d) prüfen und erfassen Sie Kassenanordnungen, Solländerungen, Stundungen und Erlassfälle Dabei verbuchen Sie bare und unbare Zahlungseingänge , inklusive Rückschecks, erstellen das Scheckeinlieferungsverzeichnis und führen interne Verrechnungen, Umbuchungen sowie Aufrechnungen durch Sie korrigiere...
Erfurt 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Erfurt suchen wir Sie zum nächstmöglichen Zeitpunkt als „ Strategischer Projektentwickler (m/w/d) “. Aufgaben Als Strategischer Projektentwickler / Business Developer Quantentechnologie **(m/w/d)** gestalten Sie die strategische Ausrichtung des Themenfelds Quantentechnologien mit – einschließlich Roadmaps, Marktanalysen und White‑Spot‑Analysen Dabei beobachten Sie technologische Trends und Marktpotenziale, erstellen Bewertungen und präsentieren Ergebniss...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als **„** Projektcontroller / Referent-Projektfinanzen (m/w/d)“. Aufgaben Als Projektcontroller / Referent-Projektfinanzen (m/w/d) übernehmen Sie das finanzwirtschaftliche Management nationaler Förderprojekte und verantworten das ganzheitliche Projektcontrolling Dabei steuern und überwachen Sie Budgets, Kosten, Erlöse, Termine sowie Liquiditätsflüsse und stellen die wirtschaftliche Projektabwicklung si...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als **„** Software Tester / Test Engineer (m/w/d)“. Aufgaben Als Software Tester / Test Engineer (m/w/d) verantworten Sie die systematische Überprüfung von Softwarelösungen auf Funktionalität, Stabilität, Qualität und Benutzerfreundlichkeit Dabei erstellen, planen und führen Sie manuelle und automatisierte Tests durch (z. B. End‑to‑End‑Tests, Regressionstests, Systemtests) Sie erstellen und verwalten F...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „HR‑Projektmanager / HR‑Prozessberater (m/w/d)“. Aufgaben Als HR‑Projektmanager / HR‑Prozessberater (m/w/d) unterstützen Sie die Personalabteilung fachlich und organisatorisch bei der Analyse, Optimierung und Standardisierung zentraler HR‑Prozesse Dabei begleiten Sie die Einführung und Anpassung von HR‑IT‑Systemen Sie analysieren und dokumentieren bestehende HR‑Abläufe, zum Beispiel Recruiting, Onb...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens im Münchner Norden suchen wir Sie zum nächstmöglichen Zeitpunkt als „Sachbearbeiter Finanzen / Verwaltungsfachkraft (m/w/d)“. Aufgaben Als Sachbearbeiter Finanzen / Verwaltungsfachkraft (m/w/d) übernehmen Sie die Planung, Organisation und Bearbeitung von Finanz- und Haushaltsangelegenheiten Dabei wirken Sie bei der Budgetkontrolle, Prüfung von Ausgaben und Erstellung von finanziellen Übersichten sowie Berichten mit Sie unterstützen bei der Erstellung von Ja...
Munich 34m ago
Show description
Im Auftrag unseres Kunden in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „Konfigurationsmanager / Produktkoordinator (m/w/d)“. Aufgaben Als Konfigurationsmanager / Produktkoordinator (m/w/d) steuern Sie das Konfigurationsmanagement für technische Produkte und komplexe Systeme Dabei stellen Sie klare, dokumentierte und nachvollziehbare Produktstände über den gesamten Produktlebenszyklus sicher Sie koordinieren Änderungen an Hardware, Software und Komponenten und behalten Versionen so...
Munich 34m ago
Show description
Im Auftrag unser Partnerunternehmen in München sucht Sie als Supplier Quality Engineer (m/w/d) / Spezialist (m/w/d) Lieferantenqualität. Aufgaben Als Spezialist (m/w/d) für Lieferantenqualität sichern Sie die Anlieferqualität und begleiten präventive Maßnahmen zur Lieferantenentwicklung Zudem steuern Sie das technische Fehlermanagement und dokumentieren Abweichungen zuverlässig im CAQ-System Auch die Moderation von Ursachenanalysen und die Definition nachhaltiger Korrekturmaßnahmen gehört zu Ihr...
Hamburg 34m ago
linux
Show description
Im Auftrag unser Partnerunternehmen in Hamburg sucht Sie als Senior Systemadministrator (m/w/d) IT-Infrastruktur. Aufgaben Als IT-Spezialist (m/w/d) im Bereich der IT-Infrastruktur stellen Sie den stabilen Betrieb moderner Enterprise-Storage-Lösungen sicher und entwickeln diese kontinuierlich weiter Zudem verantworten Sie die Konfiguration und Betreuung komplexer Netzwerkumgebungen inklusive VPN und Remote-Standorten Auch durch gezielte Automatisierung mit PowerShell optimieren Sie Prozesse und ...
Augsburg 34m ago
Show description
Im Auftrag unseres Kunden suchen wir Sie für den Standort Augsburg zum nächstmöglichen Zeitpunkt als „DevSecOps / IT Security Specialist“ Aufgaben Als DevSecOps / IT Security Specialist (m/w/d) treiben Sie die Weiterentwicklung des DevSecOps-Ansatzes in den Produkt-Teams voran Dabei führen Sie Sicherheitsanalysen und Pentests durch, leiten daraus Maßnahmen ab und verfolgen deren Umsetzung nach Sie unterstützen die DevSecOps-Teams bei der Erarbeitung übergreifender Architektur- und Sicherheitskon...
Munich 34m ago
postgresqlgitlinux
Show description
Unser Partnerunternehmen im Münchner Süden sucht Sie als „Systemadministrator (m/w/d)“. Aufgaben Als Systemadministrator (m/w/d) betreuen Sie die interne Server- und IT-Infrastruktur, einschließlich Windows-, Windows Server- und Linux-Umgebungen Dabei implementieren Sie neue Softwarelösungen und Systeme, z. B. DATEV, DATEV DMS, PostgreSQL oder GIT, und sorgen für deren reibungslosen Betrieb Sie planen, erweitern und optimieren die IT-Infrastruktur, einschließlich Servern, VServern, Workstations ...
Munich 34m ago
Show description
Du bist mitten im Studium und willst echte Einblicke in die Welt des Recruitings bekommen? Du möchtest nicht nur zusehen, sondern aktiv mitgestalten – von der Kandidatensuche bis zum Vorstellungsgespräch Bei uns arbeitest du in einem jungen, dynamischen Team, das dich fördert und inspiriert. Am Ende deines Praktikums gehst du nicht nur mit praktischem Know-how, sondern auch mit wertvollen Erfahrungen und einem echten Stolz auf deine Entwicklung nach Hause. In München unterstützen wir zahlreiche ...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens im Münchner Norden suchen wir Sie zum nächstmöglichen Zeitpunkt als „Verwaltungsfachwirt / Sachbearbeiter Finanzwesen (m/w/d)“. Aufgaben Als Verwaltungsfachwirt / Sachbearbeiter Finanzwesen (m/w/d) übernehmen Sie die Bearbeitung der Haushalts- und Finanzplanung für öffentliche Einrichtungen, Eigenbetriebe und verbundene Organisationen Dabei wirken Sie in Teilbereichen der Haushaltsüberwachung mit, einschließlich der Prüfung, Bewertung und Meldung außer- und...
Munich 34m ago
Show description
Im Auftrag unseres Kunden in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „ IT Support Specialist / IT Systemadministrator (m/w/d)“ . Aufgaben Als IT Support Specialist / IT Systemadministrator (m/w/d) übernehmen Sie den lokalen und Remote-Support für Anwender und stellen den stabilen Betrieb der IT-Arbeitsplätze sicher Dabei betreuen Sie Endgeräte und Arbeitsplatzumgebungen wie Notebooks, Desktop-PCs, Drucker, mobile Geräte und Videokonferenzsysteme unter Berücksichtigung von IT- un...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „Systemingenieur (m/w/d)“. Aufgaben Als Systemingenieur (m/w/d) betreuen Sie sie systemtechnische Entwicklung und Integration von Teil- und Gesamtsystemen Dabei leiten Sie moderne System- und Vetronil-Architekturen ab und entwickeln nachhaltige technische Lösungen Sie analysieren bestehende Systeme, erstellen technische Spezifikationen und übernehmen das vollständige Anforderungsmanagement Sie vera...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „Techniker Systemintegration / Mechatronik (m/w/d)“. Aufgaben Als Techniker Systemintegration / Mechatronik (m/w/d) verantworten Sie die komplette Systemintegration von der Montage bis zur Inbetriebnahme Dabei begleiten Sie Systeme im gesamten Projektverlauf – von der Entwicklungsunterstützung über die Hardware- und Softwareintegration bis zur erfolgreichen Übergabe an den Nutzer Sie übernehmen die...
Munich 34m ago
Show description
Join our team: Wir suchen dich als Talent Acquisition Manger (m/w/d) ! 🚀 Du möchtest die Arbeitswelt von morgen aktiv mitgestalten und bringst einen unschlagbaren Mix aus Persönlichkeit und Motivation mit? Dann solltest du auf jeden Fall weiterlesen! Bei uns triffst du auf ein junges, dynamisches Team, in dem Zusammenhalt und Teamwork an erster Stelle stehen – und Spaß darf natürlich nicht fehlen! Du wirst von Anfang an Teil unseres Recruiting-Teams sein, eigene Projekte übernehmen und so deine...
Munich 34m ago
Show description
Ready to go? Unser Partnerunternehmen in München sucht Sie als Gebäudetechniker / Technischer Gebäudemanager (m/w/d) zum nächstmöglichen Zeitpunkt. Aufgaben Als Gebäudetechniker / Technischer Gebäudemanager (m/w/d) übernehmen Sie die Überwachung, Steuerung und Optimierung der technischen Gebäude- und Versorgungssysteme Sie koordinieren und nehmen Wartungs-, Inspektions- und Instandsetzungsarbeiten ab und kontrollieren externe Dienstleister und Nachunternehmer Zudem überwachen und dokumentieren S...
Munich full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „Vertriebscontroller im Bankenumfeld (m/w/d)“. Aufgaben Als Vertriebscontroller im Bankenumfeld (m/w/d) erstellen Sie datenbasierte Reports, Kundenpotenzial-Analysen und Forecasts, um die Vertriebsstrategie zu stärken Dabei überwachen Sie Vertriebskennzahlen, analysieren Soll-Ist-Abweichungen und unterstützen bei der Zielerreichung Sie beraten das Vertriebsmanagement strategisch bei der Definition ...
Munich full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens im Münchner Norden suchen wir Sie zum nächstmöglichen Zeitpunkt als „Materialdisponent / Logistik-Koordinator (m/w/d)“. Aufgaben Als Materialdisponent / Logistik-Koordinator (m/w/d) verantworten Sie die Bestandsführung sowie die termingerechte Abwicklung aller Fertigungs- und Versandaufträge Dabei koordinieren Sie die Abläufe zwischen Intralogistik, Auftragsplanung, Materialsteuerung, Produktion, Lager, Versand und den angrenzenden Fachabteilungen Sie organ...
Frankfurt am Main full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Frankfurt suchen wir Sie zum nächstmöglichen Zeitpunkt als „Kundenberater Private Banking (m/w/d)“. Aufgaben Als Kundenberater Private Banking (m/w/d) unterstützen Sie Senior-Berater bei der ganzheitlichen Betreuung und Beratung anspruchsvoller Privatkunden sowie institutioneller Investoren Dabei pflegen Sie bestehende Kundenbeziehungen im gehobenen Privatkundensegment und tragen aktiv zum Auf- und Ausbau langfristiger Partnerschaften bei Sie wirken bei ...
Frankfurt am Main full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Frankfurt am Main suchen wir Sie zum nächstmöglichen Zeitpunkt als „Privatkundenberater / Kundenberater Bank (m/w/d)“. Aufgaben Als Privatkundenberater / Kundenberater Bank (m/w/d) übernehmen Sie die ganzheitliche Betreuung eines festen Kundenstamms – persönlich, telefonisch & digital Dabei beraten Sie Ihre Kunden zu Girokonten, Krediten, Geldanlagen, Wertpapieranlagen und Vorsorgeprodukten und entwickeln individuelle Finanzpläne Sie sind verantwortlich ...
Bad Tölz full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in Bad Tölz suchen wir Sie zum nächstmöglichen Zeitpunkt als „Privatkundenberater“. Aufgaben Als Privatkundenberater (m/w/d) übernehmen Sie die ganzheitliche Betreuung eines festen Kundenstamms – persönlich, telefonisch & digital Dabei beraten Sie Ihre Kunden zu Girokonten, Krediten, Geldanlagen, Wertpapieranlagen und Vorsorgeprodukten und entwickeln individuelle Finanzpläne Sie sind verantwortlich für aktive Neukundenakquise und Ausbau bestehender Kundenbe...
Munich full-time 34m ago
Show description
Im Auftrag unseres Partnerunternehmens in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „Bankkaufmann / Kundenberater (m/w/d)“. Aufgaben Als Bankkaufmann / Kundenberater (m/w/d) betreuen und beraten Sie Privat- und Firmenkunden in allen Fragen rund um Finanzierung, Geldanlage, Vorsorge und Zahlungsverkehr Dabei erkennen Sie individuelle Kundenbedürfnisse und entwickeln maßgeschneiderte Finanzlösungen, um langfristige Kundenbeziehungen aufzubauen und zu festigen Sie führen Kontoberatun...
Munich 34m ago
Show description
Im Auftrag unseres Partnerunternehmens suchen wir Sie zum nächstmöglichen Zeitpunkt als „IT Administrator (m/w/d)“. Aufgaben Als IT Administrator (m/w/d) sind Sie Überwachung und Durchführung der Datensicherung von IT Systemen verantwortlich Dazu gehörten auch die ganzheitliche Dokumentation sowie Protokollierung Zudem verantworten Sie den Transfer von Datenträgern, einschließlich Dokumentation für den Austausch mit externen Rechenzentren sowie regelmäßige Neuordnung Sie pflegen und überprüfen d...
Munich 34m ago
Show description
Gestalte deine Zukunft in einer Kanzlei mit globaler Ausrichtung – wo anspruchsvolle Mandate und persönliche Entwicklung Hand in Hand gehen. Im Auftrag unseres Kunden in München suchen wir Sie zum nächstmöglichen Zeitpunkt als „ Debitorenbuchhalter (m/w/d) “. Aufgaben Als Debitorenbuchhalter (m/w/d) übernehmen Sie die Verantwortung für die Rechnungsstellung im In- und Ausland Dabei unterstützen Sie bei Monats- und Jahresabschlüssen sowie der laufenden Finanzbuchhaltung Sie bearbeiten und korrigi...
Munich 34m ago
Show description
Suchen Sie einen zuverlässigen Partner, der Ihnen bei der Stellensuche in München hilft? Dann sind Sie bei der MHC goldrichtig! Profitieren Sie von der langjährigen Erfahrung unserer Experten. Dank der vertrauensvollen Zusammenarbeit mit zahlreichen Unternehmen können wir Ihnen jederzeit maßgeschneiderte Jobmöglichkeiten anbieten. Verzichten Sie auf das Schreiben zahlreicher Bewerbungen. Gemeinsam finden wir Ihren Traumjob – und das völlig kostenfrei! Im Auftrag unseres Kunden in München suchen ...
Munich 34m ago
Show description
Suchen Sie einen zuverlässigen Partner, der Ihnen bei der Stellensuche in München hilft? Dann sind Sie bei der MHC goldrichtig! Profitieren Sie von der langjährigen Erfahrung unserer Experten. Dank der vertrauensvollen Zusammenarbeit mit zahlreichen Unternehmen können wir Ihnen jederzeit maßgeschneiderte Jobmöglichkeiten anbieten. Verzichten Sie auf das Schreiben zahlreicher Bewerbungen. Gemeinsam finden wir Ihren Traumjob – und das völlig kostenfrei! Im Auftrag unseres Kunden in München suchen ...
Bad Salzuflen 34m ago
Show description
Social Media Manager / Recruiter (m/w/d) bei STEUERPARTNER Du findest die richtigen Talente – und machst uns sichtbar? Willkommen bei STEUERPARTNER. Wir sind eine moderne Steuerkanzlei mit familiären Werten, echtem Teamgeist und dem Anspruch, Dinge gemeinsam besser zu machen. Bei uns findest du flache Hierarchien, offene Türen und Menschen, die sich gegenseitig unterstützen. Bei STEUERPARTNER gestaltest du aktiv, wie wir als Arbeitgeber wahrgenommen werden und wie wir neue Kolleginnen und Kolleg...
remote Remote full-time 55m ago
azuregit
Show description
Headquarters: BR URL: http://extremedigital.com.br A Extreme Digital Solutions é uma empresa jovem, fundada em 2014, antenada nas mais modernas tendências e tecnologias. Temos como missão tornar negócios mais simples e eficientes, e, na nossa essência, a busca e integração de soluções para as mais complexas e diversas necessidades dos negócios de nossos clientes. Ao longo desse tempo atingimos a marca de 1000 colaboradores no Brasil e temos na bagagem centenas de projetos desafiadores, com uso i...
remote Remote full-time 55m ago
Show description
Headquarters: BR URL: http://alura.com.br Descrição da vaga A Alura é a maior plataforma de ensino em tecnologia do Brasil e você pode fazer parte dessa história de sucesso através dessa posição! Quer trabalhar em uma empresa que investe na sua carreira e, ainda, valoriza a educação e a tecnologia? Então #VemPraAlura #MergulheEmTecnologia É importante dizer que valorizamos a diversidade e estamos buscando tornar o nosso ambiente mais plural e inclusivo, por isso, incentivamos que mulheres, pesso...
remote Remote full-time 55m ago
pythonjavaginawsgcpazuredockerkubernetes +7
Show description
Headquarters: BR URL: http://matera.com.br Aqui na Matera , tecnologia conecta pessoas, transforma negócios e amplia possibilidades. Trabalhamos para tornar o acesso a serviços financeiros mais seguro, eficiente e democrático, desenvolvendo soluções que impactam milhões de pessoas todos os dias. Nosso time atua em projetos desafiadores, com tecnologia de ponta, autonomia e espaço para evoluir. Se você gosta de resolver problemas complexos, aprender constantemente e fazer parte de um time que con...
remote Remote full-time 55m ago
postgresqlawsdockerkubernetesterraformprometheusgrafanalinux
Show description
Headquarters: BR URL: http://luby.com.br #VemPraLuby💙 Aqui você terá a oportunidade de: Evoluir em um ambiente de alta performance: Uma cultura onde o desenvolvimento é contínuo, com autonomia e envolvimento em projetos nacionais e internacionais que realmente testam suas habilidades e impulsionam seu potencial. Integrar um time apaixonado por tecnologia: Aqui, você vai trabalhar ao lado de talentos experientes em um ambiente colaborativo e disruptivo, utilizando as tecnologias mais avançadas d...
remote Remote full-time 55m ago
pythonoraclesqlserverazuregrafanasparkairflowdbt +1
Show description
Headquarters: BR URL: http://taking.com.br Estamos em busca de um(a) profissional para garantir a sustentação N1 dos ambientes de dados em Azure, assegurando disponibilidade e performance dos pipelines em produção, monitorando e tratando incidentes com precisão técnica, promovendo otimização e automação contínua, assegurando a integridade e qualidade dos dados e atuando de forma colaborativa com Engenharia, BI e áreas de negócio para entregas consistentes e alinhadas à estratégia da organização....
remote Berlin 3h ago
javascripttypescriptpythonreactnextjsfastapipostgresqlsupabase +1
Show description
We are eliminating the finance back-office as we know it. Quid builds AI agents that automate the finance back-office for e-commerce companies and multi-location operators. We handle invoice processing, ERP posting, settlement reconciliation, and approval routing — running as a managed service for clients across Germany, Netherlands, UK, and the US. We are a small, fast-moving team of operators and builders. Tasks The Role We are looking for a product-minded early engineer who can own projects e...
remote Grünwald 3h ago
pythonrustawsazurelinux
Show description
Wir sind ein fast zwei Jahre altes IT Unternehmen, aktuell 50 MA, und suchen nun weiterhin Verstärkung, um Cloud-Projekte bei unseren Kunden durchzuführen. Aufgaben Du willst: Deine Arbeitszeiten selbst bestimmen? von zuhause aus arbeiten (remote)? den nächsten Schritt in Deiner Karriere gehen und lernen, wie man Teams leitet und ein Unternehmen führt? einen Arbeitgeber, der Dich leistungs- und ergebnisorientiert bezahlt? Qualifikation Du: bist seit 4 Jahren in Vollzeit berufstätig im Bereich So...
remote Karlsruhe 3h ago
Show description
Die Unternehmen der n-komm Firmengruppe stehen für innovative IT-Lösungen und langjährige Erfahrung in der Digitalisierung von Geschäftsprozessen. Mit unserem Fokus auf moderne ECM-Systeme unterstützen wir unsere Kunden dabei, effizienter, transparenter und zukunftssicher zu arbeiten. Dabei verbinden wir technologische Expertise mit einem hohen Qualitätsanspruch und partnerschaftlicher Zusammenarbeit. Aufgaben Planung und Umsetzung von ECM-Projekten mit Schwerpunkt ELO bei unseren Kunden Analyse...
remote Berlin 3h ago
javascripttypescriptnodejsexpresspostgresqlredissupabasellm +1
Show description
About Occibo SaaS product from IndieKidz - Occibo(occibo dot com) is an AI assisted children’s book creation studio. We are building the backend systems that power guided book creation, AI image workflows, asset generation, and production ready outputs for solo authors, teachers, and parents. Tasks Build(from scratch) and improve backend services & APIs for core product workflows using Node.js, TypeScript, and Express Work on Supabase/PostgreSQL based data models, authentication, and API integra...
remote Berlin 3h ago
pythonrustlangchainvector-dbrag
Show description
Qdrant just closed a $50M Series B to build the retrieval infrastructure layer for modern AI. Our vector search engine, written in Rust, runs in production at engineering teams inside Canva, HubSpot, Tripadvisor, Bosch, and Deutsche Telekom. We're growing our European field team and looking for a Solutioins Engineer who wants to get into the room (or the call) where real AI infrastructure decisions get made. This is a key role on a technical field team. You'll work closely with senior engineers ...
München full-time 3h ago
Show description
Du willst Ergebnisse, keine Diskussionen? Du arbeitest strukturiert, hast ein klares Verständnis für saubere Prozesse und weißt, wie wichtig Verlässlichkeit im Vertrieb ist? Dann bist du bei uns genau richtig! Wir suchen einen Senior Sales Consultant (m/w/d), der mit klarem Fokus auf Abschlussquote, Systemtreue und messbare Resultate arbeitet. In dieser Position übernimmst du Verantwortung für die direkte Kundengewinnung, führst strukturierte Verkaufsgespräche anhand erprobter Leitfäden und unte...
Berlin 4h ago
Show description
Hi, wir sind CBE DIGIDEN! Du bist in der Finanzbuchhaltung zu Hause und möchtest in einem modernen, digital aufgestellten Umfeld arbeiten? Dann bringe Deine Erfahrung im Bereich Eingangsrechnungen ein und unterstütze uns dabei, unsere Prozesse weiter zu optimieren! Was du bei uns machst Prüfung, Kontierung und Buchung von Eingangsrechnungen Sicherstellung eines termingerechten und reibungslosen Rechnungsdurchlaufs Pflege und Abstimmung von Kreditorenkonten Unterstützung bei Monats- und Jahresabs...
Berlin, Berlin, Germany 4h ago
androidfigma
Show description
At Flix, we offer a tech-driven environment where innovation meets real-world impact, with competitive pay, strong growth opportunities, and a culture of collaboration and ownership. We are looking for a Product Designer (Mobile) to help shape the future of Flix mobile experiences, making travel seamless for millions of users worldwide. In this role, you'll be one of the key contributor to developing high-quality, scalable, and user-friendly Mobile designs that enhance our passengers journey whe...
Berlin, Berlin, Germany 4h ago
segment
Show description
About Wolt At Wolt, we create technology that brings joy, simplicity and earnings to the neighborhoods of the world. In 2014 we started with delivery of restaurant food. Now we're building the delivery of (almost) everything and you'll find us in over 500 cities in 30 countries around the world. In 2022 we joined forces with DoorDash and together we keep on dreaming big and expanding across the globe. Working at Wolt isn't always easy, but it's definitely exciting. Here you'll learn more, build ...
Berlin, Berlin, Germany 4h ago
Show description
About Wolt At Wolt, we create technology that brings joy, simplicity and earnings to the neighborhoods of the world. In 2014 we started with delivery of restaurant food. Now we're building the delivery of (almost) everything and you'll find us in over 500 cities in 30 countries around the world. In 2022 we joined forces with DoorDash and together we keep on dreaming big and expanding across the globe. Working at Wolt isn't always easy, but it's definitely exciting. Here you'll learn more, build ...
Berlin 4h ago
Show description
Bei VREY bauen wir das EnergyOS für Mehrfamilienhäuser . In Deutschland stehen über 3,3 Millionen Mehrparteienhäuser – und sie sind das schwarze Loch der Energiewende. 1% Solardurchdringung. 2% Smart Metering. Kaum Flexibilität oder intelligentes Energiemanagement. Gleichzeitig zwingt die Regulierung Eigentümer zu massiven Investitionen: Solar wird zur Pflicht, Smart Meter müssen in den nächsten 5 Jahren flächendeckend ausgerollt werden, Heizung und Mobilität elektrifizieren sich. Das Mehrfamili...
Berlin full-time 4h ago
typescriptreactnestjspostgresqlgcpdockervercelturbo +1
Show description
Upway is the leading marketplace for refurbished e-bikes across Europe and the United States. Our mission is to democratize light electric mobility by making it more accessible. In just three years, we’ve repaired and sold over 40,000 bikes and expanded our operations to 7 countries. We are building the tech infrastructure that powers everything from sourcing e-bikes to running our UpCenters (repair and refurbishment facilities), delivering a seamless customer experience, and developing the most...
Berlin 5h ago
Show description
Zum nächstmöglichen Zeitpunkt suchen wir eine:n Projektmanager im Online Marketing (m/w/d) Aufgaben Du führst die Kundenbeziehung, definierst gemeinsam Ziele und Roadmaps und moderierst Kick-offs, Quartals-Reviews und Jour Fixes Du verbindest Stakeholder, hältst regelmäßigen Kontakt zu Geschäftsführung, Fachbereichen, Marketing, Sales und IT und bringst alle an einen Tisch Du entwirfst Strategien und Lösungen, triffst Kanalmix-Entscheidungen (SEO/Content, SEA, Social, CRM, Analytics)und identifi...
remote Cologne 5h ago
kubernetesoauthjwt
Show description
Du liebst Security by Design sowie Secure Development und möchtest möglichst fullremote mit einem modernen Tech-Stack echten Mehrwert schaffen? Und bist außerdem in der Lage ca. 1-2x pro Monat persönlich in Köln zu sein? Dann bist du hier genau richtig! Hier die weiteren Infos: Aufgaben Du unterstützt, sensibilisierst und schulst als wachsamer Security Champion Softwareentwicklungs-Teams in allen Schritten des Software Lifecycles Du erarbeitest anwendungsbezogene Sicherheitskonzepte, bewertest d...
remote Jena 5h ago
javapostgresqloraclesqlserverazurelinux
Show description
Join us in shaping the future of digital B2B commerce – smart, efficient, and scalable. We develop AI powered e commerce platforms for B2B clients and are looking for you to join our team. Tasks In this role, you will work on the planning, operation, optimization and support of our Microsoft SQL Servers for our E-Commerce solutions. Your responsibilities will include the following tasks: Operating our e-commerce solutions on Microsoft Azure Planning, installation, configuration, support, and adm...
Berlin 5h ago
reactdjangofastapipostgresqlawscypressplaywright
Show description
mika is revolutionizing financial management for small businesses with an AI-powered platform that combines automated accounting, proactive insights, and conversational AI. We're on a mission to make expert financial navigation and compliance accessible to every small business owner – dramatically reducing costs and bureaucratic burden. We're a small, senior team shipping fast, and every line of code we ship matters. Our stack: FastAPI & Django backend, React frontend (Material UI, react-query),...
remote Berlin 5h ago
pythonreactdjangofastapipostgresqlawsllm
Show description
mika is revolutionizing financial management for small businesses with an AI-powered platform that combines automated accounting, proactive insights, and conversational AI. We're on a mission to make expert financial navigation and compliance accessible to every small business owner – dramatically reducing costs and bureaucratic burden. We're a small, senior team shipping fast, and every line of code we ship matters. Our stack: FastAPI & Django backend, React frontend (Material UI, react-query),...
Berlin 6h ago
Show description
Wir machen das Leben von Hunden besser. Und das ihrer Menschen gleich mit. Wir suchen wir jemanden, der unsere Passion für glückliche Vierbeiner nicht nur versteht, sondern in mitreißenden Content übersetzt. Klingt spannend? Dann werde Teil unseres Teams und hilf uns, die mammalys Mission in die Social Media Welt zu tragen und die Herzen der Hundefreunde im Sturm zu erobern! mammaly ist eine der am schnellsten wachsenden Premium-Marken für Hundesupplements. Hast du Lust die Person zu sein, die u...
remote Berlin contract 6h ago
Show description
About the Job We're looking for an SEO Lead to take ownership of our affiliate portfolio and scale it. You'll work with some of the biggest publishers in the world and have a direct impact on revenue. You'll drive SEO strategy across multiple affiliate sites spanning a wide variety of verticals, lead continuous go-lives into new markets, and manage a small team of SEO Content Managers. You'll have the autonomy to set direction, prioritize what moves the needle, and act fast when things change - ...
Berlin 7h ago
Show description
We’re working with a late-stage, VC-backed technology company operating across multiple international markets. As the business continues to scale, they are looking to hire a Head of Commercial Law to lead on commercial legal strategy and partner closely with senior stakeholders across the organisation. You will take the lead on all commercial legal matters, shaping contracting strategy while supporting the business on complex, cross-border initiatives. Tasks Leading the company’s commercial lega...
Cologne 7h ago
Show description
Sociallab Markets ist eine moderne Online-Marketing-Agentur mit Fokus auf Social Media, Content-Strategien und digitale Markenkommunikation. Wir unterstützen Unternehmen dabei, online sichtbar zu werden, ihre Reichweite zu steigern und über starke Inhalte nachhaltig zu wachsen. Zur Verstärkung unseres Teams suchen wir einen kreativen und strukturierten Social Media Manager, der unsere Kundenprojekte strategisch und operativ betreut. Aufgaben Planung, Umsetzung und Betreuung von Social-Media-Stra...
Munich 7h ago
python
Show description
Der notwendige Ausbau erneuerbarer Energien erhöht die Volatilität in der Energieerzeugung und stellt das Energiesystem und v.a. Netze vor große neue Herausforderungen. Mit Luxera Energy sind wir bereit, uns diesen Herausforderungen anzunehmen: Als Plattform (von Projektplanung über Finanzierung, Bau und Betrieb) für stationäre Batteriespeichersysteme (BESS) sorgen wir für mehr Flexibilität im Energiesystem und treiben die Energiewende dadurch maßgeblich voran. Unser kleines, dynamisches Team vo...
Berlin freelance 7h ago
llm
Show description
Hi, wir sind CBE DIGIDEN! Als deutscher Partner des Netzwerks KREAB Worldwide arbeitest Du bei uns an der strategischen Beratung anspruchsvoller Kunden – von Medienarbeit über Stakeholder-Management bis zu politischer Kommunikation. Du entwickelst Kommunikationsstrategien, pflegst Beziehungen zu Medien, Politik und Verbänden und übernimmst eigenständig die Projektleitung für deine Mandate. Und Du bist nicht nur strategisch und operativ beratend, sondern auch akquisitorisch unterwegs, verantworte...
Cologne full-time 7h ago
Show description
Eight Advisory was founded in 2009 in France by 8 former partners of Arthur Andersen / Big4 companies as a firm specialized in Transaction Services, Restructuring, and Transformation. Today, Eight Advisory has grown to 850+ employees (including 102 partners) in France, the UK, Belgium, Netherlands, USA (New York), Spain, Germany and Switzerland. Together with the Eight International Network, counting over 650 employees in more than 20 countries, we respond to a growing demand for financial advic...
Cologne 8h ago
awsterraformgitlinux
Show description
Unsere IT-Landschaft entwickelt sich stetig weiter. Für Workloads, die weiterhin auf virtuellen Maschinen laufen, bauen wir eine moderne und sichere Umgebung in der AWS-Cloud auf. Wenn du Freude an cleverer Automation, klarer Struktur und teamübergreifender Zusammenarbeit hast, bist du bei uns richtig. Aufgaben Du gestaltest und betreibst eine stabile, sichere und gut automatisierte AWS Cloud-Umgebung Du bringst deine Ideen ein, um Prozesse zu verbessern und neue Lösungen zu entwickeln Du arbeit...
Leipzig 8h ago
Show description
Deine Mission: Starte mit echten IT-Projekten durch – statt grauer Theorie Du willst praktische Erfahrung sammeln und eigene IT‑Projekte umsetzen, die wirklich etwas bewegen?Dann schnapp dir deinen Laptop – und komm zu uns! Wir suchen einen Werkstudenten (m/w/d) IT & Infrastruktur , der Lust hat, Dinge auszuprobieren, mitzudenken und unsere Systeme aktiv weiterzuentwickeln. Kein Zuschauen, kein Kaffeekochen –bei uns bist du mittendrin. Aufgaben Tech-Nerd oder einfach neugierig? - Spaß an digital...
Cologne 8h ago
pythonawsterraformansiblegitbash
Show description
Wir bauen moderne, sichere und skalierbare IT‑Infrastrukturen mit Schwerpunkt auf Cloud, Netzwerk und Infrastructure as Code (IaC). Wenn du Lust hast, unsere Netzwerklandschaft aktiv mitzugestalten und Automatisierung liebst, bist du bei uns genau richtig! Aufgaben Design, Aufbau und Betrieb von Cloud‑Netzwerken in AWS – automatisiert mit Terraform, Terragrunt und Git Entwicklung von Automatisierungs‑Workflows (z. B. CI/CD, Deployment, Monitoring) zur effizienten Netzwerk‑Orchestrierung Implemen...
Berlin full-time 8h ago
llm
Show description
Planet A is a leading early-stage tech VC backing European founders tackling the world’s greatest systemic challenges. We take a scientific approach to identify breakthrough solutions the world can’t afford to ignore across energy, resource mastery, neo-manufacturing, and critical infrastructure. Investments include INERATEC, Makersite, C1, HIVED, traceless materials and 44.01. As a small team with flat hierarchies, we live by our core values: excellency, transparency, trust, humbleness, convict...
Münster 9h ago
Show description
Wir digitalisieren die Arbeitswelt von Jagd, Forst und Veterinärwesen – mit Software, die sich an der Praxis orientiert und ermöglichen digitale Schnittstellen zwischen Behörden, Betrieben und Fachanwender:innen. Unsere Plattform hilft, komplexe Verwaltungsabläufe zu vereinfachen, schafft Vertrauen und bietet Lösungen, die funktionieren und spürbar entlasten. Ob Tierseuchenmanagement, Trichinenprobenmanagement oder Revierverwaltung: Unsere Anwendungen machen Prozesse nachvollziehbar, sicher und ...
remote Berlin 9h ago
figma
Show description
About mammaly We are mammaly! - und unsere Mission sind gesunde und glückliche Hunde! Deshalb entwickeln wir Premium Supplements für Hunde, die ein langes und gutes Leben ermöglichen. Gegründet in 2020, ist mammaly bereits jetzt das führende Pet Supplement Startup in Deutschland. Darauf ruhen wir uns nicht aus, denn Tierwohl liegt uns am Herzen: Wir fördern mit innovativen Lösungen die Gesundheit und Lebensqualität unserer Hunde. Außerdem, fühlen wir uns verpflichtet, hohe soziale und ökologisch...
remote Berlin 9h ago
figma
Show description
About mammaly We are mammaly! - und unsere Mission sind gesunde und glückliche Hunde! Deshalb entwickeln wir Premium Supplements für Hunde, die ein langes und gutes Leben ermöglichen. Gegründet in 2020, ist mammaly bereits jetzt das führende Pet Supplement Startup in Deutschland. Darauf ruhen wir uns nicht aus, denn Tierwohl liegt uns am Herzen: Wir fördern mit innovativen Lösungen die Gesundheit und Lebensqualität unserer Hunde. Außerdem, fühlen wir uns verpflichtet, hohe soziale und ökologisch...
Berlin 9h ago
Show description
DIE IMMA Immobilien Management GmbH wurde 2015 gegründet hat sich auf die ganzheitliche Verwaltung und Betreuung von Einzelhandelsimmobilien spezialisiert. Der Fokus unserer Dienstleistung besteht in einer gründlichen, effektiven und kommunikationsstarken Zusammenarbeit zwischen Handwerks- und Dienstleistungsunternehmen, Mietern und Eigentümern. Aktuell befinden sich knapp 100 Fachmarktzentren in unserer Betreuung und unser Fokus liegt klar auf weiterem Wachstum. Zur Verstärkung unseres Teams su...
Hamburg 9h ago
javascripttypescriptreactnextjshonopostgresqldrizzlebun
Show description
We are building a next-generation B2B marketplace from Hamburg, — currently in stealth mode . Our approach is defined by speed, ownership, and engineering excellence . We are creating a system where technology, logistics, and pricing intelligence converge — and we are doing so with a small, highly capable team. We are looking for a highly capable Fullstack Software Engineer (primarily working student) who is eager to take ownership, build end-to-end systems, and contribute directly to the core o...
Berlin 9h ago
Show description
What do you actually do as a... …Senior Software Engineer? You are responsible for writing high-quality code following solid engineering principles and best practices. By reviewing the code of engineers at various seniority levels, you ensure that only top-notch code makes it to production. You actively contribute to improving the quality and health of our codebase, processes, and teams. Collaborating closely with product and customer experience teams, you gain a deep understanding of the featur...
Krefeld 9h ago
Show description
Bei der INCAS GmbH, einem seit 30 Jahren führenden Unternehmen in der Technologie-, Informations- und Internetbranche, bieten wir Ihnen die einzigartige Möglichkeit, als Leiter unseres IT-Teams mit den Schwerpunkten IT-Security und Netzwerk Teil unseres dynamischen Teams zu werden. In dieser essentiellen Rolle sind Sie die Schnittstelle zwischen unseren mittelständischen Kunden unserem 12-köpfigen IT-Team und dem Vertrieb. Sie sind verantwortlich für die technisch und kaufmännisch saubere Abwick...
Hilden 9h ago
Show description
Sie möchten im Vertrieb nicht nur steuern, sondern aktiv gestalten und die Performance eines Inside-Sales-Teams auf das nächste Level heben? Sie verbinden strategisches Denken mit operativer Umsetzungsstärke und treiben Umsatz, Marge und Prozesse gezielt voran? Dann erwartet Sie hier eine Schlüsselrolle im kommerziellen Zentrum eines internationalen Unternehmens. Sie möchten im Vertrieb nicht nur steuern, sondern aktiv gestalten und die Performance eines Inside-Sales-Teams auf das nächste Level ...
Borken 9h ago
Show description
Mit Freude an der Arbeit und Verantwortungsbewusstsein bei allem, was wir tun – so arbeiten wir. Als TOP‑Arbeitgeber schafft unsere Bank dafür die besten Rahmenbedingungen. Rund 650 engagierte Mitarbeitende und eine Bilanzsumme von etwa 5,2 Milliarden Euro machen uns zu einer der großen Regionalbanken im Westmünsterland: Hier sind wir verwurzelt, hier setzen wir uns ein – für eine starke Wirtschaft, eine nachhaltige Lebensqualität und ein persönlich-digitales Banking. Wir begleiten Mitglieder un...
Berlin full-time 9h ago
pythongcpdockerpytorchmachine-learninggitlinux
Show description
Location: Berlin, Germany (hybrid: 3 days in-office , 2 days remote) Join Nomitri and help bring real-world AI systems into production. We deploy computer vision solutions into retail environments across multiple countries — operating in complex edge + cloud setups and processing millions of events daily. We are looking for a Machine Learning Engineer to support the ML team in bringing state-of-the-art machine learning models to production. We work on object detection, scene understanding, self-...
Berlin full-time 9h ago
Show description
Distribusion is the world’s leading ground transportation marketplace and gives travellers seamless access to ground transportation online, from search to ticket purchase. We have built a cutting-edge B2B technology platform that connects bus, rail, and ferry operators in 70+ countries with the biggest online retailers, including Google Maps and Booking.com. We are shaping the future of travel and building the largest global network of transport providers and retailers. We are one of the fastest...
Siegen part-time 9h ago
Show description
eleQtron develops and operates full-stack quantum computers based on trapped-ion technology. Quantum computing is a new computing paradigm rapidly approaching commercial viability. Our unique approach combines laser-cooled trapped ions with microwave control and tailored magnetic fields. Our next-generation computing machines under development will be able to find solutions to problems that are out of reach today, thus enabling new innovative products and services for a brighter future. We are l...
Berlin full-time 9h ago
pythonawsgcpazurekubernetesterraformansiblemlops +4
Show description
Our Vision At Nomitri, our ambition is bold: to become a leading worldwide player in Edge AI and Computer Vision . Join Nomitri and build the infrastructure behind next-generation Edge AI systems. We deploy computer vision solutions at scale for major international retailers, running across cloud and edge environments in 15+ countries and processing millions of inferences daily. We’re looking for a senior engineer who wants to own complex systems end-to-end , make high-impact architectural decis...
Hannover full-time 9h ago
Show description
Wir suchen Werkstudenten (m/w/d) im Bereich Wirtschaft, Marketing oder IT-Management, die uns bei der Planung, Erstellung und Optimierung von Marketingkampagnen sowie firmeninternen Prozessen unterstützen. Dabei trägt dein Talent, Daten klar und wirkungsvoll zu analysieren und daraus fundierte Entscheidungen abzuleiten, maßgeblich zu unserem Marketingerfolg bei. Darüber hinaus arbeitest du mit der Geschäftsführung zusammen, um bestehende Prozesse zu verbessern. Deine Aufgabenbereiche: Mitwirkung...
Berlin contract 10h ago
figma
Show description
Wir suchen eine:n hands-on CRM-Manager mit starkem Gespür für Copywriting und grundlegenden Designkenntnissen. Du wirst unsere E-Mail- und Automationskampagnen gestalten, die Conversion optimieren und kreative Ideen in unseren CRM-Kanälen umsetzen. 40 h/w, Hybrid in Berlin befristet, mit Option auf Verlängerung Tasks Verwaltung und Umsetzung von CRM-Kampagnen Schreiben von conversionstarken, ansprechenden Texten Erstellung einfacher Visuals und Assets Kontinuierliches Testen, Optimieren und Ausw...
Greifswald 10h ago
Show description
Gestalte die Zukunft der Buchhaltung: cloudbasiert, KI‑unterstützt, papierlos. Mit modernsten Tools verantwortest du die digitale Buchhaltung unserer Mandant:innen und erstellst selbständig komplexe Monats-, Quartals- und Jahresabschlüsse nach HGB. Du bist Ansprechpartner für bilanzielle und steuerliche Fragestellungen und treibst die Optimierung der Buchhaltungsprozesse auf höchstem Niveau voran. Idealerweise bringst du Erfahrung aus einem Steuerbüro mit, hast bereits Jahresabschlüssen erstellt...
Berlin 10h ago
figma
Show description
Bist du ein kreativer Kopf, der Design lebt und auf Social Media die neuesten Trends im Blick hat? Du weißt, dass starke Designs mehr ausdrücken als Worte je könnten? Perfekt - dann könnte das hier echt ein Match sein! Als (Senior) Grafikdesigner:in / Mediengestalter:in (m/w/d) wirst du Teil eines dynamischen Teams, das Kreativität und Innovation großschreibt. Dich erwarten flache Hierarchien, flexible Arbeitszeiten und jede Menge Möglichkeiten, dich weiterzuentwickeln. Mit spannenden Marken wie...
Cologne 10h ago
linux
Show description
Wir sind ein Team von Cyber Security Expert:innen und setzen uns leidenschaftlich für den Schutz digitaler Infrastrukturen ein. Mit einer Kombination aus langjähriger Beratungserfahrung, agilen Arbeitsweisen und kontinuierlicher Weiterentwicklung unterstützen wir unsere Kunden branchenneutral und herstellerunabhängig. Dabei bieten wir interdisziplinäre Kompetenz aus einer Hand. Wir leben kollegiale Unterstützung im Team und eine respektvolle Feedback- und Fehlerkultur. Bei kniffligen Aufgaben fi...
Friedberg 10h ago
Show description
Deine Rolle Du hast ein Gespür für Menschen, erkennst Potenziale und möchtest aktiv dazu beitragen, die richtigen Talente mit den passenden Unternehmen zusammenzubringen? Dann bist du bei uns genau richtig. Als Recruiter / Talent Acquisition Manager (m/w/d) übernimmst du eine zentrale Rolle in unserem Unternehmen und gestaltest den gesamten Recruiting-Prozess eigenverantwortlich mit. Über uns Die CPU Consulting & Software GmbH ist im Bereich Professional Services seit mehr als vier Jahrzehnten a...
Berlin 10h ago
stripe
Show description
Wir suchen ab sofort eine/n Founders Associate Finance, die/der bereit ist, das Finance Department eines schnell wachsenden B2B SaaS neu zu denken 🚀 Das ist kein 9-to-5-Job. Du übernimmst gemeinsam mit unserem Gründer Domenik echte Verantwortung für das Finance Department – baust Prozesse neu auf, automatisierst was heute noch manuell läuft, und gestaltest aktiv mit, wie modernes Finance in einem Hypergrowth-Startup aussieht. 🚀 Was wir 2025 erreicht haben: Wachstum von 15 auf 45 Mitarbeiter, U...
Munich full-time 10h ago
Show description
Wer sind wir? EterniTeam hat die Lösung für Deutschlands größtes Problem im Unternehmertum: die Unternehmensnachfolge. Mit einem neuen, revolutionären Ansatz sichern wir die Nachfolge einiger der gut 1 Millionen Unternehmen, die alleine in diesem Jahrzehnt noch ihre Nachfolge regeln wollen bzw. müssen. Dabei stellen wir sicher, dass alle Beteiligten von der Lösung profitieren: die scheidenden und nachfolgenden Unternehmer:Innen und auch die Mitarbeitenden. Für diese Mission suchen wir talentiert...
Friedberg 10h ago
figma
Show description
Deine Rolle Du möchtest praktische Erfahrung im Personalbereich sammeln, dich im Recruiting einbringen und gleichzeitig kreativ an unserem Social-Media-Auftritt mitarbeiten? Dann bist du bei uns genau richtig! Über uns Die CPU Consulting & Software GmbH ist im Bereich Professional Services seit mehr als vier Jahrzehnten als erfolgreicher IT-Dienstleister im Bankenumfeld tätig. Als Tochterunternehmen der CPU Gruppe richten wir unsere Kompetenzen auf die erfolgreiche Umsetzung von Softwareprojekte...
Laatzen 10h ago
Show description
Das bewegen Sie bei uns: In Ihrer Rolle betreuen und verwalten Sie eigenständig Wohnungseigentümergemeinschaften. Sie bereiten Eigentümerversammlungen vor, führen diese durch und sorgen für eine strukturierte Nachbereitung. Zudem setzen Sie Beschlüsse um und pflegen die zugehörigen Beschluss- und Verwaltungsunterlagen. Darüber hinaus erstellen Sie Wirtschaftspläne und Jahresabrechnungen in enger Zusammenarbeit mit der Buchhaltung. Nicht zuletzt koordinieren und überwachen Sie Instandhaltungs- un...
Berlin 10h ago
Show description
1KOMMA5° Bei 1KOMMA5° verfolgen wir eine Vision: Living on wind and sunlight forever for free . Dafür bauen wir mit Heartbeat AI das Energiesystem der Zukunft. Bist du dabei? Wir bringen regionales Handwerk und skalierbare Software zusammen: Solar, Speicher, Wärmepumpe und E-Mobilität denken wir nicht einzeln, sondern steuern sie als intelligentes, integriertes Gesamtsystem in unserem virtuellen Kraftwerk. Direkt verbunden mit dem Strommarkt – in Echtzeit, vollautomatisiert. So wird Energie dann...
Cologne 10h ago
Show description
Du bist kreativ, hast ein Gespür für digitale Trends und möchtest nicht nur zuschauen, sondern selbst gestalten? Dann werde Teil des STARTPLATZ AI Hub! Der STARTPLATZ AI Hub bringt KI vom Konzept in die Realität. Als stark wachsendes Startup in NRW bieten wir praxisnahe KI-Weiterbildungen für Privatpersonen und Unternehmen. Bei uns arbeitest du an vorderster Front der KI-Revolution - mit echter Verantwortung von Tag eins. Aufgaben Als kreative Kraft sorgst du dafür, dass unsere digitalen Kanäle ...
Meerbusch 10h ago
Show description
Wir sind ein inhabergeführtes Unternehmen mit flachen Strukturen. Seit über 25 Jahren digitalisieren wir bereits die Geschäftsprozesse unserer Kunden mit unseren Software- & Beratungslösungen. Du findest unsere Lösungen bei namhaften Unternehmen in den Branchen Industrie, Handel und Non-Profit. Aufgaben Unterstützung bei Anpassungsprogrammierungen unter Anleitung erfahrener Entwickler Durchführung von Tests, Qualitätssicherung Unterstützung im Kunden-Support sowie Analyse von Anforderungen Teiln...
remote Germany full-time 15h ago
awsgcpazuredockerkubernetesmachine-learningrag
Show description
At Sonatus, we’re driving the transformation to AI-enabled software-defined vehicles. Traditional automotive software methods can’t keep pace with consumer expectations shaped by the mobile industry—where features evolve rapidly, update seamlessly, and improve continuously. That’s why leading OEMs trust Sonatus to accelerate this shift. Our technology is already in production across more than 6 million vehicles on the road today and rapidly expanding. Headquartered in Sunnyvale, CA, with 250+ em...
remote EMEA, Germany full-time 15h ago
javapostgresqlawsgcpazurekubernetesgrafanaapache +1
Show description
From Fivetran’s founding until now, our mission has remained the same: to make access to data as simple and reliable as electricity. With Fivetran, customer data arrives in their warehouses, canonical and ready to query, with no engineering or maintenance required. We’re proud that more organizations continue to leverage our technology every day to become truly data-driven. About the Role Fivetran is building data pipelines to power the modern data stack for thousands of companies. We’re seeking...
remote Ireland full-time 15h ago
javascripttypescriptpythonreactangularnodejsredisdynamodb +6
Show description
Rithum™ is the world’s most trusted commerce network, accelerating how brands, suppliers, and retailers work together to deliver seamless e-commerce experiences. We provide an unmatched platform for brands and retailers, enabling them to accelerate growth, optimise operations across channels, scale product offerings and enhance margins. Today, more than 40,000 companies trust Rithum to grow their business across hundreds of channels, representing over $50 billion in annual GMV. Using our commerc...
USD 150k-200k/yr remote EMEA full-time 15h ago
reactembermysqlawsgcp
Show description
About Customer.io Over 8,000 companies - from scrappy startups to global brands - use our platform to send billions of emails, push notifications, in-app messages, and SMS every day. Customer.io powers automated communication that people actually want to receive. We help teams send smarter, more relevant messages using real-time behavioral data. Under the hood: Go, React, Ember and AI help us ship fast and scale with confidence. We’re looking for experienced backend engineers who care deeply abo...
USD 150k-200k/yr remote EMEA full-time 15h ago
typescriptreactember
Show description
About Customer.io Over 8,000 companies - from scrappy startups to global brands - use our platform to send billions of emails, push notifications, in-app messages, and SMS every day. Customer.io powers automated communication that people actually want to receive. We help teams send smarter, more relevant messages using real-time behavioral data. Under the hood: Go, React, Ember and AI help us ship fast and scale with confidence. We’re looking for curious, driven Fullstack (Product) Engineers who...
remote Remote 1d ago
Show description
Strata Information Group (SIG) is a trusted leader in higherâeducation technology consulting, supporting colleges and universities with ERP/SIS modernization, digital transformation, CRM, cybersecurity, and strategic advisory services. As a longâstanding and deeply embedded partner within the higherâeducation sector, SIG brings together technical depth, operational insight, and a culture rooted in integrity, collaboration, and exceptional client service. Our heritage is built on handsâon...
remote 1d ago
Show description
SpecterOps is a cybersecurity solutions and services provider specializing in deep knowledge of adversary tradecraft to help clients detect and defend against sophisticated attackers. We are seeking motivated and curious students or recent graduates to join us for a summer internship. If you have a passion for learning and an interest in accounting within a fastâgrowing technology company, we want to hear from you! Internships at SpecterOps aim to offer students industry exposure and hands-on ...
USD 90k-130k/yr remote Remote 1d ago
Show description
About Medallion: At Medallion, we believe healthcare teams should focus on what truly mattersâdelivering exceptional patient care. Thatâs why weâve built a leading provider operations platform to eliminate the administrative bottlenecks that slow healthcare organizations down. By automating licensing, credentialing, payer enrollment, and compliance monitoring, Medallion empowers healthcare operations teams to streamline their workflows, improve provider satisfaction, and accelerate revenue...
remote Latin America 1d ago
Show description
Ready to accelerate your career? Clara is the fastest-growing company in Latin America. We've built the leading solution for companies to make and manage all their payments. We already help over 20,000 large and growing businesses operate with agility and financial clarity through locally issued corporate cards, bill pay, financing, and a powerful B2B platform built for scale. Clara is backed by some of the most successful investors in the world, including top regional VCs like monashees, Kaszek...
remote Seattle 1d ago
Show description
Are you interested in joining an organization with a global reach? In a world of shifting threats, Concentric is your trusted ally. Powered by elite professionals from military, government, and intelligence backgrounds. If you are passionate about intelligence, risk analysis, threat management, executive protection, security operations, or business resiliency, Concentric may be the organization youâve been searching for! Concentric is a risk consultancy specializing in delivering strategic sec...
remote Bangalore 1d ago
postgresqlrediskafkanatsgrpc
Show description
In the cloud, every second counts. On the leading edge of security, Sysdig stops attacks in real-time by instantly detecting changes in cloud security risk with runtime insights and open source Falco. Trusted by a large enterprise customer base, we are a well-funded startup, passionate open source enthusiasts at heart, and problem-solvers who are building and delivering powerful solutions to secure cloud-native applications. We have an organizational focus on delivering value to customers. We ap...
remote 1d ago
machine-learning
Show description
As a trusted global transformation partner, Welocalize accelerates the global business journey by enabling brands and companies to reach, engage, and grow international audiences. Welocalize delivers multilingual content transformation services in translation, localization, and adaptation for over 250 languages with a growing network of over 400,000 in-country linguistic resources. Driving innovation in language services, Welocalize delivers high-quality training data transformation solutions fo...
remote contract 1d ago
Show description
About Huzzle At Huzzle, we connect high-performing professionals with global companies across the UK, US, Canada, Europe, and Australia. Our clients include startups, digital agencies, and tech platforms in industries like SaaS, MarTech, FinTech, and EdTech. We match top talent to full-time remote roles where theyâre hired directly into client teams and provided ongoing support by Huzzle. Role Type: Full-time Engagement: Independent Contractor Job Summary Weâre hiring a Client Success Agent ...
USD 70k-90k/yr remote 1d ago
web3ethereumblockchain
Show description
WhiteBridge-Ltd is a young and rapidly developing company working in the field of digital markets and analytics. We bring together enterprising people who want to master modern approaches to trading, analysis and decision-making in a dynamic market environment. We are currently looking for a Junior Crypto Analyst & Trader , a novice specialist who is ready to complete training, perform real trading operations and develop under the guidance of experienced mentors. Your Responsibilities Execution...
remote Asia 1d ago
Show description
About BitMEX BitMEX stands as a globally leading exchange for crypto derivatives, offering traders a professional-grade trading platform. Since its inception in 2014, BitMEX has maintained an impeccable security record with âno coin lost, ever!â. Our platform caters to cryptocurrency derivatives traders by providing low latency, deep liquidity, and maximum availability. Currently, BitMEX offers more than 100 derivatives contracts, 16 pairs for spot trading, and an easy covert function betwee...
remote Remote contract 1d ago
Show description
Construction is the second-largest industry in the worldânearly 4x the size of SaaSâyet it still operates without the automated feedback loops that modern software teams rely on. Without real-time observability, issues are detected too late, contributing to over $3 Trillion in annual global waste. Doxel brings computer vision and AI to construction, giving teams real-time visibility into progress, risk, and execution. From hospitals to data centers, and from field leaders to executive teams,...
remote India 1d ago
Show description
About Us Our leading SaaS-based Global Employment Platform⢠enables clients to expand into over 180 countries quickly and efficiently, without the complexities of establishing local entities. At G-P, we're dedicated to breaking down barriers to global business and creating opportunities for everyone, everywhere. Our diverse, remote-first teams are essential to our success. We empower our Dream Team members with flexibility and resources, fostering an environment where innovation thrives and ev...
remote 1d ago
Show description
Please mention the word **LUXURIOUSLY** and tag RMzQuNTUuMTc0LjEzOA== when applying to show you read the job post completely (#RMzQuNTUuMTc0LjEzOA==). This is a beta feature to avoid spam applicants. Companies can search these words to find applicants that read this and see they're human.
remote Remote 1d ago
Show description
The Payments & Billing Operations Analyst plays a key role in managing billing operations, collections, supporting payments processes, and mitigating payment-related discrepancies all while maintaining excellent customer service and compliance with operational standards. The role is a part of the finance team, reporting to the Billing and Collections Manager and involves collaboration with multiple teams to help make system improvements. \n Responsibilities Billing & Collections: Manage day-to-d...
remote Bulgaria full-time 1d ago
pythondartdjangofastapipostgresqlmysqlsqliteazure +7
Show description
WorkNomads is seeking a Software R&D Engineer to join our diverse team, working remotely from the EU or from the WorkNomads base in Sofia, Bulgaria. The R&D Development Engineer is responsible not only for delivering technically sound solutions but also for ensuring that all systems meet high standards of security, reliability, and compliance. This includes designing secure APIs, protecting sensitive data across mobile and backend systems, proactively managing vulnerabilities, and embedding secu...
remote France full-time 1d ago
typescriptgitlabplaywright
Show description
Company Description Born in France in 2006, Voyage Privé has grown from an ambitious startup into becoming Europe’s leading travel tech platform. Operating across 9 markets with tens of millions of users, we're not just another e-commerce success story — we're a tech powerhouse revolutionizing online travel. What makes us unique? A mission-driven culture where performance meets impact. Our innovative campus brings together tech talent, professional athletes, students, and artists, creating an ec...
remote Romania full-time 1d ago
javascriptrubyreactangularrails
Show description
Who we are Employment Hero is on a mission to make employment easier and more valuable for everyone. Our Employment Operating System brings hiring, HR, payroll and benefits into an all-in-one solution. Since our inception in 2014, we’ve scaled to a $2 billion valuation and gained a presence in 6 countries globally - Australia, New Zealand, Singapore, Malaysia, the UK and Canada. We now service over 300,000 businesses and more than 2 million employees. The EH Way At Employment Hero, we’re proud o...
remote 2d ago
Show description
ABOUT YOU We are looking for a Sales Operations Project Manager who is highly organized to join our Operations team. The best candidate will be someone who thrives in a fast-paced, highly collaborative, and exceptionally dynamic setting and is excited to drive operational excellence, support company-wide initiatives, and ensure smooth execution of projects. Strong stakeholder, project, and tool management skills are essential. The ability to streamline processes, enhance efficiency, and manage c...
USD 0/yr remote Amsterdam contract 2d ago
python
Show description
Location: Remote Type: Contract / Part-time Commitment: 20 hours per week Compensation: Up to 40 USD / hr Project duration: 2 months , with potential extension Availability: Immediate start About the role We create high-quality STEM training data for frontier AI models used by leading AI labs to improve model reasoning in scientific domains. We are seeking experts in Biology to create challenging, deterministic problems with exactly one verifiable correct answer. Problems should reflect authenti...
USD 75k-125k/yr remote San Francisco 2d ago
pythonmachine-learningsnowflakeamplitude
Show description
Role World Golf Tour is seeking a Data Analyst to join our Product team. In this critical role, you will be the custodian of our data, organizing insights, and analyzing telemetry to support strategic business decisions. You will focus on developing and maintaining dashboards and analysis reports, collaborating across the studio and closely with the Product team to provide actionable insights that help drive the business. This role emphasizes strong data stewardship, visualization and statistica...
remote Serbia contract 2d ago
Show description
Precision for Medicine is looking for an experienced Manager, Site Contracts Management to join our European team. This position can be covered fully remotely from Poland, Slovakia, Hungary, Romania or Serbia. Position Summary: Work closely with Study Start Up, Clinical Operations, legal, HR, finance and other stakeholders to ensure Site Contracts team has all needed tools to deliver Site Contracts in the shortest possible time and play a key role to ensure all other deliverables of the Site Con...
remote 2d ago
Show description
Customer success with purpose: protect retention, fuel growth, and drive real impact in higher education. In this role, you'll own a portfolio of French-speaking partners in higher education, mostly health profession programs in medicine, nursing, and allied health. You'll guide them through their admissions cycle, protect and grow revenue, and build the kind of relationships where partners call you first and refer you to peers. That means helping partners get real value from our growing assessm...
remote Austin, TX 2d ago
Show description
About CharterUP. CharterUP is transforming the $450+ billion group transportation and mobility market with an AI native platform that powers modern charter, shuttle, and emerging autonomous vehicle operations. Trusted by many Fortune 500 companies, CharterUP connects enterprises, institutions, and event organizers to thousands of bus operators nationwide, while increasingly serving as the operating system for large scale shuttle and transit programs across airports, campuses, industrial sites, a...
remote 2d ago
Show description
About Medallion: At Medallion, we believe healthcare teams should focus on what truly mattersâdelivering exceptional patient care. Thatâs why weâve built a leading provider operations platform to eliminate the administrative bottlenecks that slow healthcare organizations down. By automating licensing, credentialing, payer enrollment, and compliance monitoring, Medallion empowers healthcare operations teams to streamline their workflows, improve provider satisfaction, and accelerate revenue...
USD 80k-110k/yr remote part-time 2d ago
javascriptphprestsassgit
Show description
About This Role Data Group Inc. is hiring a WordPress Developer for part-time remote client work across corporate, marketing, and conversion-focused web properties. This role is best suited to someone who can independently ship custom WordPress functionality, improve performance and security, and collaborate with design, content, and project stakeholders in a consulting environment.This position is fully remote within the United States and follows a flexible part-time schedule with regular u.s. ...
remote Germany 2d ago
segment
Show description
Location: Germany We Are: RTB House is a next-generation performance demand-side platform (DSP) that uses proprietary Deep Learning AI algorithms to help brands grow. The company is the market leader in driving performance using Deep Learning across the entire purchase funnel. Founded in 2012, and now operating in 90+ markets, RTB House has always been private-by-design. It embraces first-party advertising and a relentless approach to innovation. RTB House offers end-to-end Deep Learning-powered...
remote 2d ago
Show description
About Glia Glia is the leading AI customer service solution for banks and credit unions. Our platform unifies AI and human agents across every voice and digital conversation through our proprietary ChannelLess® Architecture. With AI for Allâ¢, organizations overcome the tradeoff between efficiency and experience by using AI to automate conversations and elevate service operations. Valued at over $1 billion and named a Deloitte Technology Fast 500⢠company for five consecutive years, Glia pow...
remote 2d ago
Show description
About Us SharkNinja is a global product design and technology company, with a diversified portfolio of 5-star rated lifestyle solutions that positively impact peopleâs lives in homes around the world. Powered by two trusted, global brands, Shark and Ninja , the company has a proven track record of bringing disruptive innovation to market and developing one consumer product after another has allowed SharkNinja to enter multiple product categories, driving significant growth and market share gai...
remote freelance 2d ago
Show description
Role Overview We are building a global network of independent freelance recruiters who source and place top talent across our client base. This is a commission-only, performance-driven role where you are fully responsible for sourcing your own candidates using your own tools, workflows, and networks. You will not be provided with sourcing tools, candidate databases, or inbound applicants. Instead, you will leverage your own sourcing strategies (LinkedIn, outbound, automation tools, referrals, et...
remote 2d ago
Show description
Come join our team! There are many reasons why EPIC Insurance Brokers & Consultants has become one of the fastest-growing firms in the insurance industry. Fueled and driven by capable, committed people who share common beliefs and values and âbring itâ every day, EPIC is always looking for people who have âthe right stuffâ â people who know what they want and arenât afraid to make it happen. Headquartered in San Francisco and founded in 2007, our company has over 3,000 employees nati...
remote USA full-time 2d ago
pythonjavaawsgcpazuresegment
Show description
Our Mission: Our mission is to multiply what matters: growth, retention, and efficiency. We envision a future where companies, teams and people reach their full potential. Our People: People are the heart and soul of 6sense. We serve with passion and purpose. We live by our Being 6sense values of Win as One Team, Stay Curious, Do The Right Thing, Own the Outcome, and Create Belonging. Every 6sensor plays a part in defining the future of our industry-leading technology. 6sense is a place where dif...
remote USA full-time 2d ago
Show description
Company Description Work with Us. Change the World. At AECOM, we're delivering a better world. Whether improving your commute, keeping the lights on, providing access to clean water, or transforming skylines, our work helps people and communities thrive. We are the world's trusted infrastructure consulting firm, partnering with clients to solve the worldâs most complex challenges and build legacies for future generations. There has never been a better time to be at AECOM. With accelerating inf...
remote USA full-time 2d ago
javascriptpythongonodejsclickhouseawsgcpazure +5
Show description
WHO WE ARE: For enterprises struggling to secure cloud workloads, Aviatrix® offers a single solution for pervasive cloud security. Where current cybersecurity approaches focus on securing entry points to a trusted space, Aviatrix Cloud Native Security Fabric (CNSF) delivers runtime security and enforcement within the cloud application infrastructure itself – closing gaps between existing solutions and helping organizations regain visibility and control. Aviatrix ensures security, cloud, and netw...
USD 190k-275k/yr remote USA full-time 2d ago
llm
Show description
We're hiring a Principal Technologist into the Office of the CTO. This is a hands-on problem-solver role for someone who can walk into any room in the company, listen to what's broken, and ship a working solution — not a perfect one, but a good one that gets people moving. While the CTO and CEO are building the long-term technical and strategic vision and drive the company's most transformative initiatives, your job is to handle everything that would otherwise pull them off that focus. Business ...
remote Anywhere in the world 2d ago
javascripttypescriptreactnodejsexpresspostgresqlsupabasedrizzle +3
Show description
About Coreli Coreli (coreli.ai) is an AI-powered landing page platform that generates editorial-style creator sites from Instagram handles in minutes. Think of it as a premium alternative to Linktree — except instead of a generic list of links, creators get a site that actually looks and feels like their brand. We launched a few months ago and already have ~350 paying users. The product is live, real creators, brands and professionals are using it every day, and we're at the stage where the engi...
remote Europe, EMEA full-time 2d ago
react
Show description
About Filestage Filestage frees people from chaotic approval processes, making work more joyful and productive. From large enterprises to independent agencies, our review and approval platform helps teams share, discuss, and approve all their files, all in one place – including documents, designs, images, videos, and audio files. We're a fully remote team with people working in home offices, co-working spaces, and coffee shops all over the world. Together, we're on a mission to create a seamless...
remote India contract 2d ago
Show description
About Us Pearl is AI for professional services at global scaleâcombining advanced AI with verified human expertise to deliver help that's accurate, accountable, and fast. Since 2003, our network has connected millions of customers with licensed professionals across 196 countries, making real expertise available anytime, anywhere. Our Values Data driven: Data decides, not egos Courageous: We take risks and challenge the status quo Innovative: We're constantly learning, creating, and adapting Le...
remote contract 2d ago
Show description
Skydio is the leading US drone company and the world leader in autonomous flight, the key technology for the future of drones and aerial mobility. The Skydio team combines deep expertise in artificial intelligence, best-in-class hardware and software product development, operational excellence, and customer obsession to empower a broader, more diverse audience of drone users, from utility inspectors to first responders, soldiers in battlefield scenarios and beyond. About the role: Skydio is look...
remote full-time 2d ago
Show description
Senior Manager of Revenue Cycle Management Remote, Anywhere in the US About AnswersNow At AnswersNow, we are trailblazing the future of autism therapy, making it more immediate, accessible, and effective for families everywhere. Our innovative virtual ABA therapy platform is thoughtfully designed by clinicians to recreate the focused, supportive environment of in-person therapy, complete with distraction-free features and interactive activities that enhance engagement and progress. Our team oper...
remote Remote 3d ago
Show description
At MERGE, we are Built Different . We are a marketing and technology agency purpose-built for the intersection of health and wellnessâwhere human impact matters most. By weaving storytelling through technology, we move beyond traditional engagement to Whole Human Marketing. This approach recognizes that humans are multidimensional and complex, and uses AI to ensure every brand interaction feels natural, contextual, and relevant. This commitment to human-first innovation is what brings us toget...
remote Sunnyvale 3d ago
backbonemachine-learning
Show description
Customer Program Manager Cross-Site Project Coordination | Schedule & Risk Management | High-Visibility Communication | SF Bay Area, CA ABOUT NEXXA Nexxa.ai is building artificial super intelligence for heavy industries â enabling machines, systems and operations to think, decide and act autonomously across manufacturing, large-scale infrastructure, logistics and legacy environments. Our mission is to translate deep technical breakthroughs into operational reality, solving some of the hardest ...
remote Remote, US 3d ago
Show description
About Extend: Extend is revolutionizing the post-purchase experience for retailers and their customers by providing merchants with AI-driven solutions that enhance customer satisfaction and drive revenue growth. Our comprehensive platform offers automated customer service handling, seamless returns/exchange management, end-to-end automated fulfillment, and product protection and shipping protection alongside Extend's best-in-class fraud detection. By integrating leading-edge technology with exce...
remote NY, NY 3d ago
Show description
About Us: Grow Therapy is on a mission to serve as the trusted partner for therapists growing their practice, and patients accessing high-quality care. Powered by technology, we are a three-sided marketplace that empowers providers, augments insurance payors, and serves patients. Following the mass increase in depression and anxiety, the need for accessibility is more important than ever. To make our vision for mental healthcare a reality, we're building a team of entrepreneurs and mission-drive...
remote USA 3d ago
javascriptpythonpostgresqlmysqlawsgcpsnowflakerest +1
Show description
At Counterpart Health, we are transforming healthcare and improving patient care with our innovative primary care tool, Counterpart Assistant. By supporting Primary Care Physicians (PCPs), we are able to deliver improved outcomes to our patients at a lower cost through early diagnosis and longitudinal care management of chronic conditions. We are looking for Software Engineers who are eager to tackle a variety of challenges. In this role, you will collaborate with developers, data scientists, an...
USD 5k-10k/yr remote 4d ago
Show description
Uncapped Commission | $5,000â$10,000+ per monthInstallPros USA is a national technology installation company helping homes and businesses get fast, reliable connectivity where traditional broadband falls short.We specialize in Starlink satellite intern... Please mention the word **RECONCILIATION** and tag RMzQuNTUuMTc0LjEzOA== when applying to show you read the job post completely (#RMzQuNTUuMTc0LjEzOA==). This is a beta feature to avoid spam applicants. Companies can search these words to fin...
remote Ireland full-time 4d ago
javaawsgcpazureprometheusgrafanadatadogllm +4
Show description
Who we are At Twilio, we’re shaping the future of communications, all from the comfort of our homes. We deliver innovative solutions to hundreds of thousands of businesses and empower millions of developers worldwide to craft personalized customer experiences. Our dedication to remote-first work , and strong culture of connection and global inclusion means that no matter your location, you’re part of a vibrant team with diverse experiences making a global impact each day. As we continue to revol...
remote Netherlands full-time 4d ago
Show description
Abstraction is a Dutch game co-development studio aiming to deliver cutting-edge game experiences. Specializing in technically demanding projects, we have collaborated on renowned IPs like Halo, Dune, Mass Effect, and Baldur’s Gate . Our portfolio contains over 60 titles, reflecting our commitment to quality and technical prowess. We're not just partners with industry giants such as BioWare/EA, 343/Microsoft, Funcom, Sega , and others; we're innovators in our field. As a Senior Graphics Programm...
remote Ukraine full-time 4d ago
javascriptreactnodejsaws
Show description
We are looking for a Junior QA Engineer with 3-12 months of programming background to join a healthcare project in active development. We are only considering candidates from Lviv Requirements: Must have: Completed QA courses Understanding of how mobile and web applications work Experience in writing test documentation (checklists, test cases) Intermediate English proficiency (both written and spoken) Nice to have: Healthcare experience or domain knowledge would be a big advantage Key Responsibi...
remote Ukraine full-time 4d ago
pythonangularnodejspostgresqlfirestoresentryiosandroid +1
Show description
We are looking for a proactive Middle QA engineer with 2+ years of experience to join our startup from the USA, California. Requirements Must have 2+ years of experience as a QA Engineer Hands-on experience testing hybrid or native applications on both iOS and Android platforms, web application testing, API testing (using Postman), and working with DBs (such as Firestore DB and PostgreSQL) Solid knowledge of testing theory: test processes, test design techniques, and test documentation. Experien...
remote Croatia full-time 4d ago
javaspringpostgresqloracleawsgcpdockerapache +2
Show description
Ingemark is a custom software development agency trusted by some of the largest companies in Southeast Europe, as well as a number of companies from Western Europe, the Middle East, and the U.S. We love technology, but our true passion lies in using it to help our clients run their business better. Because the bottom line is, well, their bottom line. Who Are We Looking For? If you’re a Java developer and you have: Experience in working with Java Knowledge and experience in working with Spring an...
remote UK full-time 4d ago
pythonawsgcpterraformgrafanadatadognewrelicpagerduty
Show description
Who we are Samsara (NYSE: IOT) is the pioneer of the Connected Operations™ Cloud, which is a platform that enables organizations that depend on physical operations to harness Internet of Things (IoT) data to develop actionable insights and improve their operations. At Samsara, we are helping improve the safety, efficiency and sustainability of the physical operations that power our global economy. Representing more than 40% of global GDP, these industries are the infrastructure of our planet, in...
remote EMEA full-time 4d ago
javascripttypescriptreactnextjsexpressnestjspostgresqldocker +7
Show description
Who we are is what we do. Deel is the all-in-one payroll and HR platform for global teams. Our vision is to unlock global opportunity for every person, team, and business. Built for the way the world works today, Deel combines HRIS, payroll, compliance, benefits, performance, and equipment management into one seamless platform. With AI-powered tools and a fully owned payroll infrastructure, Deel supports every worker type in 150+ countries—helping businesses scale smarter, faster, and more compl...
remote Poland full-time 4d ago
javascriptpythonjavaawsgcpazuremachine-learning
Show description
About Atos Group Atos Group is a global leader in digital transformation with c. 67,000 employees and annual revenue of c. €10 billion, operating in 61 countries under two brands — Atos for services and Eviden for products. European number one in cybersecurity, cloud and high performance computing, Atos Group is committed to a secure and decarbonized future and provides tailored AI-powered, end-to-end solutions for all industries. Atos Group is the brand under which Atos SE (Societas Europaea) o...
remote WA DC 4d ago
Show description
Founded in early 2021, Ibility is a Service-Disabled Veteran-Owned Small Business and a Woman-Owned Small Business, headquartered in Gaithersburg, MD. Ibility is a small but mighty company that is positioned for rapid growth. Simply put, we help government leaders to achieve their mission by designing creative products and programs that delight their customers and make their employees more efficient - building trust and improving overall satisfaction. We use human-centered design principles in e...
remote Crofton, MD part-time 5d ago
Show description
At LifeStance Health, we believe in a truly healthy society where mental and physical healthcare are unified to make lives better. Our mission is to help people lead healthier, more fulfilling lives by improving access to trusted, affordable, and personalized mental healthcare. Everywhere. Every day. Itâs a lofty goal; we know. But we make it happen with the best team in behavioral health. Thank you for taking the time to explore a career with us. As the fastest growing behavioral health pract...
USD 250k-310k/yr remote San Francisco 5d ago
Show description
This is Adyen Adyen provides payments, data, and financial products in a single solution for customers like Meta, Uber, H&M, and Microsoft - making us the financial technology platform of choice. At Adyen, everything we do is engineered for ambition. For our teams, we create an environment with opportunities for our people to succeed, backed by the culture and support to ensure they are enabled to truly own their careers. We are motivated individuals who tackle unique technical challenges at sca...
remote full-time 5d ago
Show description
About the Role We are hiring a Manager of Revenue Operations to lead the systems, automation, and data infrastructure that power how the business sells, retains, and serves members. This is a senior, hands-on leadership role responsible for owning the RevOps stack end to end, from CRM architecture to reporting and workflow automation. You will manage a small technical operations team while acting as the primary owner of HubSpot, automation workflows, and business intelligence. This role requires...
remote United States (East Coast Time Zone) - Remote contract 5d ago
web3blockchain
Show description
About MoonPay Hi, weâre MoonPay. Weâre here to onboard the world to the decentralized economy by making digital money move as universally and effortlessly as the internet. Why? Because crypto, stablecoins and blockchain arenât just technologies. Theyâre tools for global financial empowerment. They give people and businesses more control over their money, their digital assets, and their future, opening access to legacy financial systems that have been out of reach for many. What we do Moo...
remote United States 5d ago
Show description
At WISEcode, we're a well-funded, dynamic startup. WISEcode makes personalized nutrition a reality based on the facts â what truly is in our food â and marries this data with your preferences. Powered by AI and the worldâs best food and nutrition database, WISEcode embraces the fact that we are all different, have different dietary needs, objectives, and preferences, and should not be at the mercy of market spin or âexpertâ opinion. Every one of us should have the information we need t...
remote 5d ago
pythonllmmachine-learninglangchainrag
Show description
About Fullscript Weâre an industry-leading health technology company on a mission to help people get better. We started in 2011 with one simple idea. Make it easier for practitioners to access the products they trust so they can deliver better care. That simple idea grew into a platform that powers every part of care. Today, more than 125,000 practitioners use Fullscript for clinical insights, lab interpretations, patient analytics, education, and access to high-quality supplements. Over 10 mi...
remote 5d ago
javascriptpythonswiftawsgcpkubernetesterraformdatadog +1
Show description
About MoonPay Hi, weâre MoonPay. Weâre here to onboard the world to the decentralized economy by making digital money move as universally and effortlessly as the internet. Why? Because crypto, stablecoins and blockchain arenât just technologies. Theyâre tools for global financial empowerment. They give people and businesses more control over their money, their digital assets, and their future, opening access to legacy financial systems that have been out of reach for many. What we do Moo...
remote Hawthorne, CA full-time 5d ago
Show description
SpaceX was founded under the belief that a future where humanity is out exploring the stars is fundamentally more exciting than one where we are not. Today SpaceX is actively developing the technologies to make this possible, with the ultimate goal of enabling human life on Mars. RECRUITING COORDINATOR â TEMPORARY POSITION As a recruiting coordinator at SpaceX, your primary responsibility is to schedule all candidate onsite interviews, as well as making sure that candidates have a great exper...
remote 5d ago
javascriptpythonswiftnodejsawsgcpgithub-actionscloudflare +1
Show description
About MoonPay Hi, weâre MoonPay. Weâre here to onboard the world to the decentralized economy by making digital money move as universally and effortlessly as the internet. Why? Because crypto, stablecoins and blockchain arenât just technologies. Theyâre tools for global financial empowerment. They give people and businesses more control over their money, their digital assets, and their future, opening access to legacy financial systems that have been out of reach for many. What we do Moo...
USD 75k-100k/yr remote NY City 6d ago
machine-learningmixpanel
Show description
About Nabla We are a team of entrepreneurs, clinicians and engineers committed to bringing back joy to the practice of medicine. Together with a community of clinician innovators, weâve harnessed the best of machine learning science to develop Nabla: the leading AI assistant thatâs restoring the human connection at the heart of healthcare. By streamlining clinical documentation, Nabla is helping clinicians focus on what matters most - patient care. Today, over 85,000 clinicians across 130+ h...
remote NY, NY contract 6d ago
Show description
Welcome to Fi. Weâre a passionate team from Square, Google, TikTok, Peloton, Uber, and more working to transform the human-pet relationship. Our mission? Develop cutting-edge technology to revolutionize what it means to be a pet parent. The pet industry remains firmly stuck in the past and we are here to change that. Fi is leveraging our team's talent and expertise to improve the lives of millions of pets in the U.S. Real-time location tracking, activity, sleep and behavior monitoring â and ...
remote 6d ago
Show description
Who We Are: SmithRx is a rapidly growing, venture-backed Health-Tech company. Our mission is to disrupt the expensive and inefficient Pharmacy Benefit Management (PBM) sector by building a next-generation drug acquisition platform driven by cutting edge technology, innovative cost saving tools, and best-in-class customer service. With hundreds of thousands of members onboarded since 2016, SmithRx has a solution that is resonating with clients all across the country. We pride ourselves for our mi...
remote Remote 6d ago
machine-learningairflowdbt
Show description
Who We Are: SmithRx is a rapidly growing, venture-backed Health-Tech company. Our mission is to disrupt the expensive and inefficient Pharmacy Benefit Management (PBM) sector by building a next-generation drug acquisition platform driven by cutting edge technology, innovative cost saving tools, and best-in-class customer service. With hundreds of thousands of members onboarded since 2016, SmithRx has a solution that is resonating with clients all across the country. We pride ourselves for our mi...
USD 60k-150k/yr remote contract 6d ago
machine-learning
Show description
Job Type: Â Contract Location: Â Remote Job Summary: Join our customer's team as an AI Data Specialist, contributing to the development and improvement of cutting-edge AI systems. In this role, you will work closely with data and AI workflows to ensure high-quality outputs that power machine learning models. This is an ideal opportunity for detail-oriented generalists who are curious about technology and excited to work at the intersection of data and AI. Key Responsibilities: Work with differen...
remote USA full-time 6d ago
pythondjangofastapipostgresqlazurekubernetesmachine-learningdatabricks +1
Show description
We are Kubikware™, a digital agency with 20+ years of experience designing and developing web and mobile platforms, as well as video games, AR/VR apps, and AI/ML. We are headquartered in Miami, FL with a strong South American team, and have clients and partners in the US market of all sizes and verticals. Among other accolades, we are a 5-time Inc. 5000 Fastest Growing Companies in America honoree We are looking to expand our amazing roster with a Python Engineer with Data Focus who is well-vers...
remote Remoto 6d ago
goelixir
Show description
Quem é Stone Tech? A Stone nasceu com o propósito de ser protagonista na transformação da indústria de pagamentos, lutando para oferecer as melhores soluções para quem empreende no Brasil. Pensando nisso, construÃmos a Stone Tech! A junção dos times de tecnologia Stone Co. e as empresas financeiras do grupo que reconhecem o potencial empreendedor de cada brasileiro. Por aqui, temos todas as inovações e tecnologias de ponta da Stone, Pagar.me, Ton e Vitta, com uma galera referência...
remote contract 6d ago
aws
Show description
Job Role: Salesforce Technical Consultant Compensation range: $3,000 AUD - $4,000 AUD / Monthly Engagement type: Independent Contractor Agreement Work Schedule: This role is expected to align with the AU business hours (approx. 9 AM - 5 PM, Monday to Friday) for collaboration, but as a contractor, youâll have flexibility in how you manage your time. Who We Are: At Hunt St, we help Australian companies hire top remote talent in the Philippines. For this role, you will be engaged directly by the...
remote Remote full-time 6d ago
Show description
At Curai, we believe that access to high-quality healthcare is a fundamental human right, not a privilege. Our mission is to radically transform healthcare by harnessing the power of artificial intelligence and clinical expertise to make care more affordable, accessible, and effective for everyone. We are currently seeking a compassionate, experienced Nurse Practitioner to join our weekend care delivery team to provide high-quality, patient-centered, virtual-first primary care to patients across...
remote Hyderabad 6d ago
Show description
Are you an expert in Windows internals with a passion for low-level software engineering? At Ivanti, you'll have the opportunity to develop and maintain critical Windows applications, services, and device drivers used by organizations worldwide to manage and secure their digital environments. As a vital member of our Secure Unified Endpoint Management team, you'll shape both on-premises and SaaS solutions, ensuring seamless performance and security across all deployment landscapes. Why this role...
remote NY City 6d ago
pythonpostgresqlawsgcpazurellmgrpc
Show description
Arbiter is the AI-powered care orchestration system that unites healthcare. We are launching our best-in-class, patient-facing Agentic platform to optimize patient outcomes through a unique multimodal approach. We optimize complex healthcare workflows that interface with patients using the latest Agentic AI approaches, and we combine it with a sophisticated platform to serve this Agentic layer at scale. We are looking for expert engineers and leads to join our team and help us push the frontier ...
remote contract 6d ago
amplitude
Show description
We're looking for a Product Marketing Manager who will own the ecommerce vertical - end to end. This means you'll be the person who understands our ecommerce customers better than anyone else in the building: their workflows, their pain points, how they think about tools, and what moves them from "interested" to "convinced." This is not a support role. You'll be expected to come with ideas, build programs from scratch, drive cross-functional initiatives, and see them through to results. You'll w...
remote Portugal 6d ago
llmstripe
Show description
Who we are At Fluxon, we believe that how you build matters as much as what you build. We help businesses navigate their most important technology decisions with confidence, and take responsibility for seeing them through. Founded by ex-Googlers and startup veterans, we're proud to partner with teams behind some of the most ambitious products, including Google, OpenAI, Anthropic, Walmart and Stripe. Our work spans strategy, design, and engineering â often in complex, AI-driven environments â...
remote 6d ago
Show description
Iovance Biotherapeutics aims to be the global leader in innovating, developing and delivering tumor infiltrating lymphocyte (TIL) therapy for people with cancer. We are pioneering a transformational approach to treating cancer by harnessing the ability of the human immune system to recognize and attack diverse cancer cells in each patient. The Iovance TIL platform has demonstrated promising clinical data across multiple solid tumors. We are committed to continuous innovation in cell therapy, inc...
remote NY 6d ago
gcpairflow
Show description
This role is remote (US-based; east coast preferred) Company Overview Join a dynamic team that's redefining consumer data analytics. We empower top investment firms and global consumer and corporate brands with cutting-edge insights into consumer spending, leveraging privacy-compliant data across geographies. Our real-time intelligence and merchant-level benchmarks give clients a competitive edgeâand you'll be at the forefront of it all. Role Summary We're looking for a seasoned VP of Data Eng...
USD 10k-30k/yr remote full-time 6d ago
Show description
Social Media Content Creator ð Fully Remote | Full-Time | Remote Chess Academy (RCA) About Remote Chess Academy Remote Chess Academy (RCA) is a global leader in digital chess education. Founded by Grandmaster Igor Smirnov , we empower chess players worldwide to reach their full potential through structured video courses and elite training methodologies. With a massive global following, we are dedicated to making master-level chess knowledge accessible to everyone. Check us out: youtube.com/@G...
remote Europe, North America, Latin America, APAC full-time 6d ago
javascripttypescriptpythonrustgojavaphpreact +20
Show description
Are you a talented Senior Developer looking for a remote job that lets you show your skills and get decent compensation? Look no further than Lemon.io — the marketplace that connects you with hand-picked startups in the US and Europe. What we offer: The rate depends on your seniority level, skills and experience. We've already paid out over $11M to our engineers. No more hunting for clients or negotiating rates — let us handle the business side of things so you can focus on what you do best. We'...
USD 30-40/yr remote USA full-time 6d ago
pythonrubyphpperlmysqlapachelinuxbash
Show description
THIS IS WHO YOU ARE… You are our front line in the battle for exceptional customer experience at the 24/7/365 help desk. Ideally, you have experienced terrible web hosting customer service and have vowed that will never happen on your watch! You are responsible for seeing that our customers have excellent customer service by doing what you do every day -> exceeding customer expectations. WHAT DO WE NEED FROM YOU? Well, you should be customer focused, great under pressure, and ready to engage a p...
remote 6d ago
Show description
Who we are is what we do. Deel is the all-in-one payroll and HR platform for global teams. Our vision is to unlock global opportunity for every person, team, and business. Built for the way the world works today, Deel combines HRIS, payroll, compliance, benefits, performance, and equipment management into one seamless platform. With AI-powered tools and a fully owned payroll infrastructure, Deel supports every worker type in 150+ countriesâhelping businesses scale smarter, faster, and more com...
remote 6d ago
Show description
We are looking for an Associate Director, Chemistry Manufacturing and Controls (CMC) to join our A-team. As an Associate Director, CMC at Allucent, you are responsible for assisting clients with Chemistry Manufacturing and Control (CMC) and related pharmaceutical development activities of drug, biologic or medical device products. The specific experience for CMC is small molecule (solid, liquid, oral, topical, injectable (sterile products), inhalation. We are mainly focused on pre-approval produ...
remote Peru 6d ago
Show description
What Makes Us Unique At Cloudbeds, we're not just building software, we're transforming hospitality. Our intelligently designed platform powers properties across 150 countries, processing billions in bookings annually. From independent properties to hotel groups, we help hoteliers transform operations and uplevel their commercial strategy through a unified platform that integrates with hundreds of partners. And we do it with a completely remote team. Imagine working alongside global innovators t...
remote 6d ago
swift
Show description
Mercier Consultancy MD is excited to announce an opening for a Spanish Speaking Customer Service Agent with a leading electronics company. This role provides the opportunity to work in beautiful Greece while offering superior support to Spanish-speaking customers. Your expertise and dedication will play a vital role in ensuring a positive customer experience with our innovative electronic products. Responsibilities Provide exceptional support to Spanish-speaking customers via phone, email, and c...
remote 6d ago
machine-learning
Show description
About Waymark Waymark is a mission-driven team of healthcare providers, technologists, and builders working to transform care for people with Medicaid benefits. Our community-based care teamsâpowered by proprietary data science and ML technologiesâsupport care for tens of thousands of Medicaid members across multiple states, driving measurable reductions in avoidable emergency department visits and hospitalizations. We're designing tools and systems that bring care directly to those who need...
remote 6d ago
Show description
Nex is on a mission to help families rediscover the joy of movement. Created by parents for parents, Nex combines technology and play to deliver fun, social, and interactive experiences powered by natural body motion, encouraging kids and adults to move more, play more, and have fun together. Nex Playground, the companyâs award-winning active play system, is purpose-built to get families moving year-round, with safety and privacy as core considerations in its intentional design. It is certifie...
remote 6d ago
reactmachine-learning
Show description
About the Role OpenRouter is the largest marketplace of LLMs, providing a unified API to access and orchestrate models across providers. As the platform grows, so does the complexity of how developers discover, evaluate, and integrate models into real applications. Weâre hiring a Product Designer to help shape both the product and how itâs presented. This role spans core product surfaces (user dashboards, documentation, model pages, rankings, policy & guardrails, chatroom) and external-facin...
remote 1w ago
Show description
MinIO is the industry leader in high-performance object storage and the company behind the worldâs fastest, most widely deployed object store, powering production infrastructure for more than half of the Fortune 500, including 9 of the 10 largest global automakers and all 10 of the largest U.S. banks. Our enterprise offering, AIStor, is engineered to handle the scale, speed, and pressure of modern AI and analytics, from terabytes to exabytes, all in a single namespace. As a Site Reliability En...
remote Minneapolis 1w ago
Show description
At Anaplan, we are a team of innovators focused on optimizing business decision-making through our leading AI-infused scenario planning and analysis platform so our customers can outpace their competition and the market. What unites Anaplanners across teams and geographies is our collective commitment to our customers' success and to our Winning Culture. Our customers rank among the who's who in the Fortune 50. Coca-Cola, LinkedIn, Adobe, LVMH and Bayer are just a few of the 2,400+ global compan...
remote Bangalore 1w ago
newrelic
Show description
We are a global team of innovators and pioneers dedicated to shaping the future of observability. At New Relic, we build an intelligent platform that empowers companies to thrive in an AI-first world by giving them unparalleled insight into their complex systems. As we continue to expand our global footprint, we're looking for passionate people to join our mission. If you're ready to help the world's best companies optimize their digital applications, we invite you to explore a career with us! S...
remote Hyderabad 1w ago
newrelic
Show description
We are a global team of innovators and pioneers dedicated to shaping the future of observability. At New Relic, we build an intelligent platform that empowers companies to thrive in an AI-first world by giving them unparalleled insight into their complex systems. As we continue to expand our global footprint, we're looking for passionate people to join our mission. If you're ready to help the world's best companies optimize their digital applications, we invite you to explore a career with us! A...
remote NY, NY freelance 1w ago
Show description
Vox Media is seeking a proactive, highly organized Studio Manager to oversee our premier podcast and video production facility in downtown Manhattan. As the "face of the studios," you will ensure a world-class environment for our talent and production teams while managing the complex daily logistics of a high-growth media environment. This is a full-time 6-month temporary position. WHAT YOU'LL DO ⢠Oversee the daily operations of a fleet of podcast studios and video stages to ensure a seamles...
remote POL Virtual 1w ago
Show description
Senior Product Manager, Checkout and Post-Booking | Tripadvisor About Tripadvisor The Tripadvisor Group connects people to experiences worth sharing, and aims to be the worldâs most trusted source for travel and experiences. We leverage our brands, technology, and capabilities to connect our global audience with partners through rich content, travel guidance, and two-sided marketplaces for experiences, accommodations, restaurants, and other travel categories. The subsidiaries of Tripadvisor, I...
remote Remote, US 1w ago
Show description
What is Amplemarket all about? Amplemarket's premise is that a lot of the playbooks used by B2B sales teams that worked 5 years ago don't cut it anymore. In today's environment, sales teams need to have a tremendous amount of information about their prospects to decide when is the best moment and channel to reach out in the most relevant way. You can't do this with 5 different data/sales enablement point solutions that don't share the same data schema and barely communicate with each other. Ampl...
remote Global full-time 1w ago
javascripttypescriptreactsqlserverazuregit
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is shaped...
remote CET (+/- 3 hours) full-time 1w ago
gopostgresqlmysqlmongodbredisawsgcpazure +8
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
javascripttypescriptreactnextjsjestcypressgit
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is shaped...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
javascriptreactnodejsmongodb
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is shaped...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
pythonawsdockerterraformapachellmpandasvector-db +5
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
pythongcpdockerkubernetesterraformansibleprometheusgrafana +1
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfil their dreams and objectives. Proxify is shaped ...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
javascripttypescriptnodejsnestjspostgresqlmysqlmongodbaws +11
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
pythondjangopostgresqlawsgcpdockerkubernetes
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote CET (+/- 3 hours) full-time 1w ago
sqlserver
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is shaped...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
javascripttypescriptpythonreactvuenextjsnuxtdjango +20
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is shaped...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
pythondjangoflaskfastapiawsgcpazuredocker +10
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
javascriptpythonazuremachine-learning
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
git
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
javascriptphpreactalpinejsmysqlrediselasticsearchdocker +3
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Time zone: CET (+/- 3 hours) full-time 1w ago
pythonflaskfastapiphoenixawsgcpazurellm +4
Show description
About us: Talent has no borders. Proxify's mission is to connect top developers around the world with the opportunities they deserve. So, it doesn't matter where you are; we are here to help you fast-track your independent career in the right direction. 🙂 Since our launch, Proxify's developers have successfully worked with 1200+ happy clients to build their products and growth features. 5000+ talented developers trust Proxify and its network to fulfill their dreams and objectives. Proxify is sh...
remote Romania full-time 1w ago
pythonjavamachine-learning
Show description
Company Description We're Nagarro. We are a digital product engineering company that is scaling in a big way! We build products, services, and experiences that inspire, excite, and delight. We work at scale — across all devices and digital mediums, and our people exist everywhere in the world (18 000+ experts across 39 countries, to be exact). Our work culture is dynamic and non-hierarchical. We're looking for great new colleagues. That's where you come in! By this point in your career, it is no...
remote Brazil, Estonia, Spain full-time 1w ago
javascripttypescriptpythongoswiftkotlindartreact +16
Show description
At Veriff, we are exploring the next frontier of identity verification: agentic AI systems that can reason, act, and operate safely in high-trust environments. We are forming a small, high-leverage team to explore and productionize agentic capabilities across identity, KYA, risk assessment, and automation workflows. We are looking for a Founding Engineer to help build this from the ground up. You’ll help us protect honest people online by: Design and build agentic systems that can: Use tools; Re...
remote 1w ago
web3
Show description
Molecule and BIO.xyz are building the foundation of Decentralized Science (DeSci) â where biotech meets web3 to make scientific research community-owned, transparent, and faster to market. Molecule provides the infrastructure to turn intellectual property (IP) into programmable, on-chain assets through our IP-NFT framework and evolving protocol stack. This enables researchers, patients, and communities to fund and govern biotech projects in new, open ways. BIO.xyz is the coordination and econo...
remote 1w ago
Show description
Paired is a global staffing and recruiting agency that pairs remote work with top-tier talent. We help individuals from around the world connect with great companies that are looking for their specific skill set. Our mission is to provide great jobs to talented people, no matter where they are located. We are looking for a skilled Video Editor to create and optimize high-performing video ads, focusing on GTC (generic) style content that drives strong ROAS. Responsibilities Edit and produce video...
USD 1k-2k/yr remote full-time 1w ago
Show description
Job Type: Full-time, long-term contractorWorkplace: RemoteSchedule: Full-time, Monday to Friday 9:00 am - 6:00 pm PSTCompensation: $1,300 - $1,900/monthAt HireHawk, we connect top global ... Please mention the word **GRATIFICATION** and tag RMzQuNTUuMTc0LjEzOA== when applying to show you read the job post completely (#RMzQuNTUuMTc0LjEzOA==). This is a beta feature to avoid spam applicants. Companies can search these words to find applicants that read this and see they're human.
remote Remote full-time 1w ago
elasticsearchsqlserverawsapacherest
Show description
Info on the Senior Developer - Backend/Search - CD+E (491) role Ready to take the next step in your international career? We can support you! Ubiminds is a GPTW-certified, people-first company that partners with American software product companies to scale their global teams. We curate top LATAM talent and connect professionals with long-term, high-impact opportunities while providing full employer-of-record support. In this role, youâll join a team focused on modernizing CI/CD pipelines and b...
remote India, Philippines part-time 1w ago
Show description
Role Summary We are seeking a driven, design-focused professional to join the team of a top-tier U.S.-based commercial furniture dealer representing some of the world's leading brands, including Haworth, Steelcase, Teknion, Kimball etc. Whether part-time or full-time, you will be a key contributor on a close-knit teamâsupporting the development of creative workspace solutions using CET and related design tools. You will play a vital role in producing fast-turnaround, high-quality design presen...
remote contract 1w ago
Show description
The Role: Care Without the ClutterAre you a Board-Certified PMHNP who loves clinical work but hates the administrative grind? We are looking for independent, patient-focused practitioners to join our telehealth network.As a 1099 Contractor, you aren't bogged down by insurance billing, credentialing, or practice management. You focus on what you do best: treating patients.Our platform handles the rest.Clinical AutonomyFull control over your schedule, patient load, and treatment approach. No produ...
USD 148k-174k/yr remote 1w ago
aws
Show description
At Vanta, our mission is to help businesses earn and prove trust. We believe that security should be monitored and verified continuously, and we empower companies to practice better security and prove it with ease. Vanta has a kind and talented team, and while some have prior security experience, many have been successful at Vanta without it. As a Senior Manager, Strategic Partner Marketing at Vanta, you will own the marketing strategy and growth motion for AWS and a portfolio of Vantaâs most...
remote Stockholm 1w ago
llmsnowflakestripe
Show description
About Zip Here at Zip, we're reimagining how modern businesses function in the age of AI. The simple task of buying software, services, or tools at work has become hopelessly complicated at even the most innovative companies in the world. Today, enterprises spend $120T+ per year globally (>30 times larger than annual consumer e-commerce spend) and rely on vendors more than ever before to run their businesses. Our co-founders started Zip in 2020 to address this seemingly universal problem with a ...
remote NY City full-time 1w ago
pythonawsterraformdatadoggitlinuxbash
Show description
Copia Automation brings modern developer tools and resiliency to industrial automation. Our product provides Git-based source control for automation professionals as well as remote, real-time monitoring of the entire plant floor + state of the art backup and recover technology. We are a well-funded startup and with a growing list of happy customers throughout the industrial space. As a Copia employee, youâll solve challenging, unique, and meaningful problems alongside passionate coworkers, whi...
remote USA full-time 1w ago
backboneawsgcpazurekubernetesllm
Show description
About the Team Security is at the foundation of OpenAI’s mission to ensure that artificial general intelligence benefits all of humanity. The Security team protects OpenAI’s technology, people, and products. We are technical in what we build but operational in how we execute, and we support every product and research effort at OpenAI. Our tenets include prioritizing for impact, enabling researchers and developers, preparing for future transformative technologies, and fostering a strong, collabor...
USD 253k-469k/yr remote USA full-time 1w ago
awsgcpazurekubernetesraglinux
Show description
Veeam is the Data and AI Trust Company, specializing in helping organizations ensure their data and AI are fully understood, secured, and resilient to enable the acceleration of safe AI at scale. As the market leader in both data resilience and data security posture management, Veeam is built for the convergence of identity, data, security, and AI risk. Headquartered in Seattle with offices in more than 30 countries, Veeam protects over 550,000 customers worldwide, who trust Veeam to keep their ...
USD 138k-184k/yr remote USA full-time 1w ago
backbone
Show description
Who is Tenable? Tenable® is the Exposure Management company. 44,000 organizations around the globe rely on Tenable to understand and reduce cyber risk. Our global employees support 65 percent of the Fortune 500, 45 percent of the Global 2000, and large government agencies. Come be part of our journey! What makes Tenable such a great place to work? Ask a member of our team and they’ll answer, “Our people!” We work together to build and innovate best-in-class cybersecurity solutions for our custom...
USD 147k-184k/yr remote USA full-time 1w ago
Show description
About Zscaler Zscaler accelerates digital transformation to ensure our customers can be more agile, efficient, resilient, and secure. As an AI-forward enterprise , we are constantly pushing the envelope, leveraging the world’s largest security data lake to power our cloud-native Zero Trust Exchange platform. This innovation protects our customers from cyberattacks and data loss by securely connecting users, devices, and applications in any location. Here, impact in your role matters more than ti...
remote USA full-time 1w ago
Show description
Meta Platforms, Inc. (Meta), formerly known as Facebook Inc., builds technologies that help people connect, find communities, and grow businesses. When Facebook launched in 2004, it changed the way people connect. Apps and services like Messenger, Instagram, and WhatsApp further empowered billions around the world. Now, Meta is moving beyond 2D screens toward immersive experiences like augmented and virtual reality to help build the next evolution in social technology. To apply, click “Apply to ...
remote LATAM full-time 1w ago
pythonswiftkotlindjangomachine-learningflutteriosandroid
Show description
We are Kubikware™, a digital agency with 20+ years of experience designing and developing web and mobile platforms, as well as video games, AR/VR apps, and AI/ML. We are headquartered in Miami, FL with a strong South American team, and have clients and partners in the US market of all sizes and verticals. Among other accolades, we are a 5-time Inc. 5000 Fastest Growing Companies in America honoree. We are looking to expand our amazing roster with a Senior Full-Stack Mobile Engineer who is well-v...
remote Europe, North America, Latin America, APAC full-time 1w ago
javascriptpythonrustgojavaphpreactvue +15
Show description
Are you a talented Senior DevOps looking for a remote job that lets you show your skills and get decent compensation? Look no further than Lemon.io — the marketplace that connects you with hand-picked startups in the US and Europe. What we offer: The rate depends on your seniority level, skills and experience. We've already paid out over $11M to our engineers. No more hunting for clients or negotiating rates — let us handle the business side of things so you can focus on what you do best. We'll ...
remote Portland, Maine 1w ago
Show description
Fire Protection Engineer Colby Co. Engineering Portland, ME (Hybrid/Remote) Colby Co. Engineering (Colby Co.) is seeking a Fire Protection Engineer to join their team. This position can be fully remote for the right candidate located in New England or the Greater New York area. Colby Co. Engineering is a privately held, multi-disciplinary team of engineers (civil, mechanical, structural, electrical, fire protection) and architects who work together on a wide range of projects from new constructi...
remote Remote 1w ago
Show description
Are you ready to join a growing team that puts a premium on productivity and has an award-winning culture centered around transforming talented employees into effective business leaders? Then BHG Financial is the place for you. In 2001, we started with an idea, an opportunity, and $25,000. Back then, our focus was strictly â¨on serving those in the medical industry. With healthcare in our heritage, we soon expanded â¨to serve high-earning professionals in many â¨other industries, providing al...
remote REMOTE - US 1w ago
Show description
Iterable is the leading AI-powered customer engagement platform that helps leading brands like Redfin, SeatGeek, Priceline, Calm, and Box create dynamic, individualized experiences at scale. Our platform empowers organizations to activate customer data, design seamless cross-channel interactions, and optimize engagementâall with enterprise-grade security and compliance. Today, nearly 1,200 brands across 50+ countries rely on Iterable to drive growth, deepen customer relationships, and deliver ...
remote 1w ago
Show description
Who is Boulevard? Boulevard provides the first and only client experience platform for appointment-based, self-care businesses. We empower our customers to give their clients more of the magical moments that matter most. Before launching in 2016, our founders spent months interviewing salon managers and working behind front desks to understand their pain points so we could design a modern, user-friendly platform that meets the unique needs of their business. Our roots may be in hair salons, but ...
remote Remote 1w ago
Show description
Vannevar is a defense technology company building AI to deter our adversaries. Â In the 21st century, conflict moves at algorithmic speed and foresight equals firepower. Our agentic AI is purpose-built to compete with Chinaâfrom cross-Strait conflict to gray zone coercion. Trained on the most mission-relevant datasets in defense, our technology models adversary behavior, simulates campaigns, and recommends the best course of action to decision makers. Our AI systems are some of the most truste...
remote Huila 1w ago
Show description
About Turing Based in San Francisco, California, Turing is the worldâs leading research accelerator for frontier AI labs and a trusted partner for global enterprises looking to deploy advanced AI systems. Turing accelerates frontier research with high-quality data, specialized talent, and training pipelines that advance thinking, reasoning, coding, multimodality, and STEM. For enterprises, Turing builds proprietary intelligence systems that integrate AI into mission-critical workflows, unlock ...
remote United States 1w ago
Show description
Superhuman offers a dynamic hybrid model, and candidates in this role can be based remotely. You may be expected to travel to meet in person during your teamâs scheduled collaboration weeks. Managers will determine in-person time according to business needs. About Superhuman Grammarly is now part of Superhuman, the AI productivity platform on a mission to unlock the superhuman potential in everyone. The Superhuman suite of apps and agents brings AI wherever people work, integrating with over 1...
USD 50k-70k/yr remote 1w ago
web3ethereumblockchain
Show description
Elemental Terra is an international company working with digital assets, market research, and data-driven trading solutions. We are building a team of specialists who want to understand how crypto markets operate in practice and develop professional skills in a real market environment. We are opening a Crypto Trader position for candidates who are at the beginning of their professional journey and are interested in trading, market analysis, and data-driven decision-making. This role involves ind...
remote Brazil, Argentina full-time 1w ago
figma
Show description
C4Media, Inc. is seeking a motivated, fully remote Junior Project Coordinator (contractor) to join our global team. In this role, you will provide essential support for our expanding online learning and certification cohorts. As a Junior Project Coordinator, you will assist the team in planning and executing our virtual learning programs for software professionals. This is a foundational, entry-level role designed for someone who thrives on organization, clear communication, and the "behind-the-...
remote Spain full-time 1w ago
pythonrustgojavaclickhouseawsgcpazure +3
Show description
Senior Backend Engineer - PerfectScale by DoiT Location Our Senior Backend Engineer will be an integral part of our EMEA engineering teams. This full-time remote role is open to employees based in the UK, Ireland, Estonia, Netherlands, Sweden, and Spain, and to contractors across other EMEA locations, including Eastern Europe and Portugal Who We Are DoiT is a global technology company that works with cloud-driven organizations to leverage the cloud to drive business growth and innovation. We com...
remote Ukraine full-time 1w ago
javascripttypescriptawskubernetesllmplaywright
Show description
Description Automat-it is where high-growth startups turn when they need to move faster, scale smarter, and make the most of the cloud. As an AWS Premier Partner and Strategic Partner, we deliver hands-on DevOps and FinOps and GenAI support that drives real results. We work across EMEA, fueling innovation and solving complex challenges daily. Join us to grow your skills, shape bold ideas, and help build the future of tech. We’re looking for a Senior Automation QA Engineer to join a high-scale, s...
remote UK full-time 1w ago
rest
Show description
General information Reference 002116 Publication start date 23/03/2026 Publication end date 07/04/2026 Post Description Salesforce Developer Vacancy location Location South West, Gloucestershire, Rosehill - Hybrid Vacancy details Job Profile Digital Services - Technical Teams Title Salesforce Developer Contract Type Full Time About us About UCAS UCAS is at the heart of connecting people to higher education. UCAS is the world’s leading shared admissions service for higher education. We provide ap...
remote UK full-time 1w ago
awsgcpazuresnowflakedatabricks
Show description
Location: Our Solutions Engineer, SELECT by DoiT, will be an integral part of our Solutions Engineering team in EMEA. This role is based remotely in the UK. Who We Are DoiT is a global technology company that empowers cloud-driven organizations to achieve business growth and innovation through strategic cloud utilization. We combine data, technology, and human expertise to ensure our customers operate in a well-architected and scalable state—from initial planning to full-scale production. With d...
remote Germany full-time 1w ago
javascriptjavarest
Show description
Overview Our scene layers team focuses on creating and working with scalable 3D content across ArcGIS. This includes 3D service creation and maintenance in ArcGIS Enterprise and ArcGIS Online. This team works to quickly build and grow new functionality around the OGC-standards like I3S or 3D tiles specification, allowing our users to do more with their data at each release and unleash The Science of Where ® . As a product engineer, your focus will be on ArcGIS Enterprise and ArcGIS Online to tes...
remote Remote 1w ago
javaangular
Show description
Callibrity is a developer owned and managed custom software development consulting company that is dedicated to creating quality software using modern technologies and adding unquestionable business value to companies across multiple industries and verticals. We are problem solvers...people who like a challenge and enjoy working with modern tech stacks. We offer an incredibly collaborative culture and enjoy solving complex problems with our clients. The Role As a Lead Front End Software Engineer...
remote United States 1w ago
Show description
Company Overview: Blink Health is the fastest growing healthcare technology company that builds products to make prescriptions accessible and affordable to everybody. Our two primary products â BlinkRx and Quick Save â remove traditional roadblocks within the current prescription supply chain, resulting in better access to critical medications and improved health outcomes for patients. BlinkRx is the worldâs first pharma-to-patient cloud that offers a digital concierge service for patients...
remote 1w ago
azure
Show description
WEâRE HIRING! At HTG, youâll push boundaries with the latest tech (in some cases inventing it) and collaborate with a team that loves what they do. Join a design services company at the forefront of global technology and innovation where the products you help build are used around the world. Your next chapter starts here.  Your responsibilities include: ⢠Lead assessments, roadmaps, and reference architectures for M365 + data estate (on-prem/Azure/multi-cloud). ⢠Define controls, scope,...
remote Poland full-time 1w ago
llm
Show description
Company Description Welcome to the good side of tech You might have heard about us, but with a different name: Znany Lekarz . It all started more than 10 years ago, when we asked ourselves: is anyone in healthcare thinking about patients? We jumped in and we empowered patients by giving them access to leave and read reviews about their visit. We then provided doctors with the technology to manage bookings easily and save time, so they could devote themselves to what they always wanted: treating ...
remote Czechia full-time 1w ago
pythonjavaspringawsdockerkubernetessparkdatabricks
Show description
Company Description Cint is a global software leader in technology-enabled digital insights and research technology. The Cint platform automates the insights-gathering process so that companies can gain access to insights faster with unparalleled scale. Cint has one of the world’s largest consumer networks for digital survey-based research, made up of over 239 million engaged respondents across more than 130 countries. Over 4,600 insights-driven companies use Cint to accelerate how they gather c...
remote Remote full-time 1w ago
rustweb3blockchain
Show description
Headquarters: Remote Global (US, EU) Aptos is a people-first blockchain on a mission to help billions of people achieve universal and fair access to decentralized assets in a safe and scalable way. Founded by some of the original creators and maintainers that researched, designed, and built the Diem blockchain to serve this purpose, we have dedicated several years toward this mission. We believe the open-source Diem technology we have developed is an important foundation of a safe and scalable w...
remote Remote full-time 1w ago
postgresqldynamodbawsterraformansiblejenkinsgitlabprometheus +2
Show description
Headquarters: Latvia Intetics Inc., a leading American technology company specializing in custom software application development, distributed professional teams creation, software product quality assessment, and “all-things-digital” solutions, is looking for a Senior DevOps to join its innovative team. Infrastructure as Code (IaC) & Automation: Design, implement, and manage AWS infrastructure using Terraform Automate provisioning and configuration management with Ansible Maintain idempotent & r...
remote Remote full-time 1w ago
digitalocean
Show description
Headquarters: Austin Dive in and do the best work of your career at DigitalOcean. Journey alongside a strong community of top talent who are relentless in their drive to build the simplest scalable cloud. If you have a growth mindset, naturally like to think big and bold, and are energized by the fast-paced environment of a true industry disruptor, you’ll find your place here. We value winning together—while learning, having fun, and making a profound difference for the dreamers and builders in ...
USD 160k-218k/yr remote Remote full-time 1w ago
javascripttypescriptpythongoc#nodejsawsazure +10
Show description
Headquarters: UNITED STATES - Remote, EMEA - Remote, CANADA - Remote, LATAM - Remote Consensys is the leading blockchain and web3 software company founded by Joe Lubin, CEO of Consensys and Co-Founder of Ethereum. Since 2014, Consensys has been at the forefront of innovation, pioneering technological developments within the web3 ecosystem. Through our product suite, including the MetaMask platform, Infura, Linea, Diligence, and our NFT toolkit Phosphor, we have become the trusted collaborator fo...
USD 120k-145k/yr remote Remote full-time 1w ago
pythonawsgcpazurekubernetesterraformgithub-actionscircleci +3
Show description
Headquarters: New York At H1, we believe access to the best healthcare information is a basic human right. Our mission is to provide a platform that can optimally inform every doctor interaction globally. This promotes health equity and builds needed trust in healthcare systems. To accomplish this our teams harness the power of data and AI-technology to unlock groundbreaking medical insights and convert those insights into actions that result in optimal patient outcomes and accelerates an equita...
remote Remote full-time 2w ago
Show description
Headquarters: 6 Rue dArmaillé Paris, Île-de-France, 75017 France Description de l'offre d'emploi À propos d’Alphorm: Alphorm est le leader de l’e-learning IT en français, engagé à proposer des formations innovantes, accessibles et de haute qualité. Notre mission est de développer les compétences de demain et de rendre l’apprentissage professionnel accessible partout dans le monde. Rejoindre Alphorm, c’est participer à une aventure éducative stimulante et impactante. Description du poste: Nous re...
remote Remote full-time 2w ago
javascriptpythongodockerkubernetesblockchainlinuxbash
Show description
Headquarters: Singapore As our DevOps Engineer, you will be helping us build and maintain blockchain networks and protocols. You will work on improving our current infrastructure including security, automation, and monitoring among other things. You will also have the chance to dive deep into new blockchain protocols, run testnets, build secure and scalable infra and maintain it. What will you do? Build secure and reliable infrastructure to monitor, detect and mitigate performance and security i...
remote France full-time 2w ago
pythonreactkubernetespytorchtensorflowmachine-learning
Show description
NVIDIA has been transforming computer graphics, PC gaming, and accelerated computing for more than 25 years. It’s a unique legacy of innovation that’s fueled by great technology—and amazing people. Today, we’re tapping into the unlimited potential of AI to define the next era of computing. An era in which our GPU acts as the brains of computers, robots, and self-driving cars that can understand the world. Doing what’s never been done before takes vision, innovation, and the world’s best talent. ...
remote UK full-time 2w ago
pythonawsgcpazurelinuxbash
Show description
As a global leader in cybersecurity, CrowdStrike protects the people, processes and technologies that drive modern organizations. Since 2011, our mission hasn’t changed — we’re here to stop breaches, and we’ve redefined modern security with the world’s most advanced AI-native platform. Our customers span all industries, and they count on CrowdStrike to keep their businesses running, their communities safe and their lives moving forward. We’re also a mission-driven company. We cultivate a culture...
USD 106k-132k/yr remote USA full-time 2w ago
javaspringmysqlelasticsearchawsdockerterraformgitlab +6
Show description
POSITION SUMMARY: Are you ready to make a real impact on people's lives and be a part of a rapidly-growing team? Natera is seeking a Software Engineer III to help design, develop, and maintain our Commercial Services, a critical backend microservice that powers our business operations. As a member of our engineering team, you will play a key role in processing and managing commercial services, ultimately helping to positively impact patient outcomes. Join us in our mission to change the way dise...
remote USA full-time 2w ago
python
Show description
Meta is seeking a Performance & Capacity Engineer to join the Capacity Planning Optimization Engineering team to lead software systems and process design. You will build and optimize infrastructure capacity planning covering all of Meta, in one of our largest transformations to date of how we plan and manage infrastructure capacity. This is a hands on leadership role, building some of the most complex parts of the system yourself while leading other engineers and non technical contributors.You w...
remote USA full-time 2w ago
oracle
Show description
Meta is seeking a Design Project Lead and Architect experienced in the design and construction of Critical Facilities to become part of our Data Center Design Engineering organization. Our data centers are the foundation upon which our software operates. Building and operating reliable and efficient data centers is essential to support the growth of Meta. The Data Center Design Engineering organization collaborates with all key stakeholders to ensure design and engineering of our data centers in...
USD 120k-135k/yr remote USA full-time 2w ago
pythonawskubernetesterraformgitlablinuxbash
Show description
ECS is seeking a highly experienced Software Engineer to work remotely. The ideal resource will have experience with: AWS, Python, Bash, Terraform, GitLab, Kubernetes, Linux, XML, along with an AWS certification. We are seeking a remote Software Engineer with experience in the research, design, and development of computer and network software or specialized utility programs. The software Engineer will analyze user needs, develop software solution, update software, and enhance existing software c...
USD 12/hr remote Philippines full-time 2w ago
pythonrustdockerllmpytestgitlinuxbash
Show description
Please submit your CV in English and indicate your level of English proficiency. Mindrift connects specialists with project-based AI opportunities for leading tech companies, focused on testing, evaluating, and improving AI systems. Participation is project-based, not permanent employment. About the Role This project is suited for a Senior Python developer with deep functional testing experience, strong Linux and Docker skills, the ability to read code across multiple languages with the support ...
remote Vietnam 2w ago
javascriptreactvuegit
Show description
Software Engineer Intern (.Net , Vue/React) Top 3 Reasons To Join Us ● International Environment ● Working on the latest tech for the Insurtech Market Leader ● Professional Development Opportunities About Us At CoverGo, our mission is to empower all insurance companies to make insurance 100% digital and accessible to everyone. ● We are a leading global no-code insurance platform for health, life, and P&C ● We’re the winner of the Insurtech of the Year in all of Asia and other awards globally ● W...
remote Vietnam full-time 2w ago
javascripttypescriptawsdockerkubernetesdatadogmachine-learningplaywright
Show description
Take the clearer route to smart career growth. At clearer.io , we’re reimagining eCommerce by enhancing search, discovery, and customer engagement through a standout suite of innovative apps. Our mission is straightforward yet powerful: to empower our partners with solutions that streamline their operations, foster customer trust, and drive sustainable growth. We’re not just about technology - we’re about making eCommerce smarter, simpler, and more impactful, delivering solutions that inspire co...
remote Singapore full-time 2w ago
javascriptjava
Show description
ABOUT MONEYTHOR Moneythor is an award-winning global enterprise software company based in Singapore providing banks and fintech firms world-wide with a modern technology platform to enhance their digital banking services, with a prime focus on the generation of data-driven personalised recommendations and insights for consumers and businesses. Moneythor is headquartered in Singapore and with presence in London, Paris, Dubai, Tokyo, and Sydney, with further expansion in progress. OVERVIEW Are you...
USD 14/yr remote USA freelance 2w ago
machine-learningiosandroid
Show description
Looking for a freelance opportunity where you can make an impact on technology from the comfort of your home? If you are dynamic, tech-savvy, and always online to learn more, this part-time flexible project is the perfect fit for you! A Day in the Life of a Personalized Internet Assessor: ● In this role, you’ll be analyzing and providing feedback on texts, pages, images, and other types of information for top search engines, using an online tool ● Through reviewing and rating search results for ...
USD 130-150/yr remote USA full-time 2w ago
awsdockerkubernetesterraformansible
Show description
The Role: Architect of a Resilient Future We are seeking a highly experienced and motivated Senior DevOps/Security Engineer to join our founding engineering team. This isn't just another DevOps role. You will be the architect of the resilient, scalable, and secure foundation upon which our entire autonomous marketing platform is built. As the first dedicated DevOps/Security hire, you will have a unique opportunity to shape our infrastructure from the ground up, ensuring our platform can deliver ...
remote Poland full-time 2w ago
javascripttypescriptiosandroidplaywright
Show description
We are a leading trading platform that is ambitiously expanding to the four corners of the globe. Our top-rated products have won prestigious industry awards for their cutting-edge technology and seamless client experience. We deliver only the best, so we are always in search of the best people to join our ever-growing talent team.| We are looking for a QA Engineer with hands-on experience in both manual and automation testing, who enjoys collaboration and thrives in a fast-paced environment. Jo...
remote Poland full-time 2w ago
Show description
Who are we? Founded in 2013, Housecall Pro helps home service professionals (Pros) streamline every aspect of their business. With easy-to-use tools for scheduling, dispatching, payments, and more, Housecall Pro enables Pros to save time, grow profitably, and provide best-in-class service. Housecall Pro’s brand portfolio includes Business Coaching by Housecall Pro, a business coaching solution for home services businesses. Our brands are united by a singular mission to champion our Pros to succe...
remote Netherlands full-time 2w ago
javapostgresqlmysqlrediskuberneteskafkalinux
Show description
About Zscaler Zscaler accelerates digital transformation to ensure our customers can be more agile, efficient, resilient, and secure. As an AI-forward enterprise , we are constantly pushing the envelope, leveraging the world’s largest security data lake to power our cloud-native Zero Trust Exchange platform. This innovation protects our customers from cyberattacks and data loss by securely connecting users, devices, and applications in any location. Here, impact in your role matters more than ti...
remote Canada, Netherlands, USA full-time 2w ago
javascripttypescriptjavakotlinvuenodejsgitlab
Show description
GitLab is the intelligent orchestration platform for DevSecOps. GitLab enables organizations to increase developer productivity, improve operational efficiency, reduce security and compliance risk, and accelerate digital transformation. More than 50 million registered users and more than 50% of the Fortune 100* trust GitLab to ship better, more secure software faster. The same principles built into our products are reflected in how our team works: we embrace AI as a core productivity multiplier,...
remote Switzerland full-time 2w ago
pythonjavaphpreactmysqlgraphqlrest
Show description
We're all about helping brands turn ideas into impact. Frontify’s brand platform transforms how teams organize digital assets, collaborate on projects, and create engaging campaigns. Our people empower thousands of marketers and designers — including teams at Uber, Microsoft, Volkswagen, and Telefónica — to build engaging brands. With headquarters in St. Gallen, Switzerland, and offices in London and New York City, we share a vibrant culture built on creativity, collaboration, inclusion, and joy...
remote UK full-time 2w ago
javajenkinsrestgitoauth
Show description
About Ping Identity: At Ping Identity, we believe in making digital experiences both secure and seamless for all users, without compromise. We call this digital freedom. And it's not just something we provide our customers. It's something that inspires our company. People don't come here to join a culture that's built on digital freedom. They come to cultivate it. Our intelligent, cloud identity platform lets people shop, work, bank, and interact wherever and however they want. Without friction....
remote USA full-time 2w ago
Show description
Role: Customer Success Representative AutoHDR is the fastest growing AI startup in real estate media. We train custom image editing models for real estate, and are currently editing 25% of all US real estate listings! Join our team and work with an exceptional team to build cutting edge products and continue growing 20% month over month! Our vision is to produce the majority of media for the real estate industry - and you can join early on. The role: Own customer retention; build systems, automa...
remote USA full-time 2w ago
Show description
Company Description AutoHDR is an AI real estate photo editing platform. We launched less than a year ago and already edit 25% of U.S. real estate listings. We’re building a category-defining product and looking for people who want to help us scale it fast. This is an early hire on a small team of A players changing the industry. Role Description We’re hiring a Customer Support Rep to own inbound support and make sure the product is delivered well to users. This is not a passive support role. We...
remote Poland full-time 2w ago
javascripttypescriptreactemberdockerjenkinsgitlabllm +3
Show description
Company Description Shiji is a global technology company dedicated to providing innovative solutions for the hospitality industry, ensuring seamless operations for hoteliers day and night. Built on the Shiji Platform—the only truly global hotel technology platform—Shiji’s cloud-based portfolio includes Property Management System , Point-of-Sale , guest engagement , distribution , payments , and data intelligence solutions for over 91,000 hotels worldwide, including the largest chains. The best h...
remote Europe full-time 2w ago
javascripttypescriptpythonjavapostgresqlkubernetes
Show description
A Little About Us EDB provides a data and AI platform that enables organizations to harness the full power of Postgres for transactional, analytical, and AI workloads across any cloud, anywhere. EDB empowers enterprises to control risk, manage costs and scale efficiently for a data and AI led world. Serving more than 1,500 customers globally and as the leading contributor to the vibrant and fast-growing PostgreSQL community, EDB supports major government organizations, financial services, media ...
remote Europe full-time 2w ago
pythonpostgresqlraglinuxbash
Show description
A Little About Us EDB provides a data and AI platform that enables organizations to harness the full power of Postgres for transactional, analytical, and AI workloads across any cloud, anywhere. EDB empowers enterprises to control risk, manage costs and scale efficiently for a data and AI led world. Serving more than 1,500 customers globally and as the leading contributor to the vibrant and fast-growing PostgreSQL community, EDB supports major government organizations, financial services, media ...
remote France full-time 2w ago
javascriptpythonrustjavadatadog
Show description
Datadog is committed to open source. It starts with our Agent, tracers, libraries, and SDKs all being open source. But it goes so much further. From open standards to open collaboration, it’s a core part of who we are and what we do. As part of the Open Source Program Office (OSPO), you will be focusing on building tools, documentation, policies, etc. that improve how our engineers interact with Open Source projects (our own and third-party projects), as well as representing Datadog in Open Sour...
remote UK full-time 2w ago
Show description
TrustedHousesitters is a fast growing, direct-to-consumer marketplace that is redefining pet care and travel. Here at TrustedHousesitters, we’re on a mission to make travel work better for pets, for their people, and for the global community of animal lovers who look after them. We’ve got big plans on becoming the world’s most-loved travel solution for pet people. We’ve built something pretty special: a trusted place where pet owners and sitters connect to keep pets happy at home while their hum...
USD 90-150/yr remote Americas, Europe, Israel contract 2w ago
Show description
You must be located in the Americas, Europe, or Israel to apply. A·Team is a VC-backed, stealth, application-only home on the internet for senior independent software builders to team up with hand-picked, high-growth companies on their next big thing. After talking with hundreds of independent engineers, designers, and product folks, we heard over and over that finding vetted, high-quality, consistent clients is hard, and projects are often too small to be rewarding. A·Team matches small teams o...
USD 120-170/yr remote Americas, Europe, Israel contract 2w ago
llmmachine-learning
Show description
Location: Americas, Europe, or Israel The Opportunity Join A.Team’s invite-only network of senior builders and access exclusive missions with Fortune 500s and top startups. This isn’t client work or employment—it’s a vetted collective where you’re matched to impactful projects. At A.Team, you won’t just implement someone else’s plan. You’ll be the technical decision-maker, owning everything from model design to enterprise integration. Why A.Team Elite peers : ex-OpenAI, Google, Meta, Amazon. Pre...
remote USA full-time 2w ago
pythongoawsgcpazuredockerkubernetesterraform +3
Show description
Staff Software Engineer (Platform) The role, in a nutshell: We are seeking a talented and experienced Software Engineer to join our team to develop and maintain the core infrastructure and development platform. The platform team is responsible for designing, building, and scaling our core services, including authentication, database, API, SDK, and chainctl. In this role, you will be responsible for helping accelerate our internal engineering teams, as well Chainguard’s customers. What you’ll do:...
USD 140k-180k/yr remote USA full-time 2w ago
pythonjavaseleniumgit
Show description
ECS is seeking a Human Capital Management (HCM) Platform Automation Developer to work remotely . The HCM Platform Automation Developer supports the design, development, and maintenance of automated solutions for the agency’s yet to be acquired HCM Platform implementation. This role focuses on streamlining integrations, testing, reporting, and business processes to enhance system efficiency and user experience. The ideal candidate has experience in HCM Platform and other automation frameworks, an...
USD 120k-165k/yr remote USA full-time 2w ago
Show description
ECS is seeking a Full Stack Software Developer to work in our Arlington, VA office / remote . We are currently seeking an organized, detailed oriented, and driven Full Stack Developer to join our team. This role will entail working closely with the client to understand needs and pain points as well as designing, configuring, and implementing technical solutions across a range of programming languages, cloud platforms, and supporting infrastructure. Responsibilities: Create innovative solutions t...
remote Poland full-time 2w ago
pythonjava
Show description
Role Description As an Infrastructure Engineer on Telemetry team, your role will be crucial in shaping and constructing the robust systems that not only support our current flagship products but also lay the groundwork for the next wave of engineering innovations. The Telemetry team owns and operates the Observability platform at Dropbox - an efficient, user-friendly platform that empowers Dropboxers with the insights to operate reliable and performant systems. In this role you will be responsib...
remote Portugal full-time 2w ago
aws
Show description
Who we are At Fortis Games we aspire to make great games that bring people together while redefining how game companies work. We believe in building a sense of belonging through our games, their communities, and how we operate and treat each other. Through our game communities, we will create powerful connections and lasting memories. We will foster a culture of diversity, equity and belonging where together our diverse skills, experiences and backgrounds impact the games we make. We are an earl...
remote Portugal full-time 2w ago
pythonmysqlrediselasticsearchawsgcpazurekubernetes +7
Show description
Sword Health is shifting healthcare from human-first to AI-first through its AI Care platform, making world-class healthcare available anytime, anywhere, while significantly reducing costs for payers, self-insured employers, national health systems, and other healthcare organizations. Sword began by reinventing pain care with AI at its core, and has since expanded into women’s health, movement health, and more recently mental health. Since 2020, more than 700,000 members across three continents ...
USD 170-200/yr remote USA, Canada, USA timezones full-time 2w ago
javascriptrubyreactrailspostgresqlmysqlrediselasticsearch +7
Show description
About Mitre Media Mitre Media is redefining FinTech with AI-driven tools that empower millions of investors. Our portfolio, including Dividend.com and MutualFunds.com, leverages LLMs to deliver novel data insights and visually rich user experiences. For over a decade, we’ve served individual investors, financial advisors, and top asset managers like BlackRock and Vanguard through our premium data, tools, and advertising solutions. Join our lean, entrepreneurial team to shape the future of AI-pow...
USD 160-180/yr remote USA, Canada, USA timezones full-time 2w ago
pythonjavascalabackboneawsgcpapachellm +6
Show description
About Mitre Media Mitre Media is redefining FinTech with AI-driven tools that empower millions of investors. Our portfolio, including Dividend.com and MutualFunds.com, leverages LLMs to deliver novel data insights and visually rich user experiences. For over a decade, we’ve served individual investors, financial advisors, and top asset managers like BlackRock and Vanguard through our premium data, tools, and advertising solutions. If you’re excited by the intersection of big data, AI, and invest...
remote Remote full-time 2w ago
pythonllmmachine-learning
Show description
Headquarters: Remote - USA About the RoleAbnormal Security is revolutionizing both cybersecurity and internal operations through advanced AI solutions. As we scale, we're establishing AI Transformation Pods to drive operational efficiency across our organization. These pods are critical to the company's overall AI strategy, offering unique visibility with the CEO and executive leadership.The AI Product Builder owns the development of internal GTM solutions, identifying opportunities for automati...
USD 336-504/yr remote Worldwide full-time 2w ago
javascripttypescriptpythonpostgresqlsupabasegithub-actionsvercelnetlify
Show description
We are looking for a strong Full-Stack Developer to execute product features and contribute to our core platform development. Your focus will be clean, scalable implementation and high-quality execution. This role is ideal for a developer who enjoys building real product features end-to-end in a focused, no-bureaucracy environment. Responsibilities Implement frontend features using TypeScript Develop backend services and APIs using Supabase / PostgreSQL Contribute to our Python-based AI & analyt...
USD 150-200/yr remote Worldwide contract 2w ago
awsfigmalinuxstripe
Show description
We are recruiting a Sr. Firmware Engineer to contribute to our IoT teams Original job posting link 🌎 About garden3d We are worker owned creative collective, innovating on everything from brands and IRL communities to IoT devices and cross platform apps. We share profit, open source everything, spin out new businesses, and invest in exciting ideas through financial and/or in-kind contributions. Our client roster includes Google , Stripe , Figma , Hinge , Black Socialists in America , ACLU , Prat...
remote Slovenia full-time 2w ago
nodejsgcpkubernetesterraformgrafanadbt
Show description
Welcome to Planet. We believe in using space to help life on Earth. Planet designs, builds, and operates the largest constellation of imaging satellites in history. This constellation delivers an unprecedented dataset of empirical information via a revolutionary cloud-based platform to authoritative figures in commercial, environmental, and humanitarian sectors. We are both a space company and data company all rolled into one. Customers and users across the globe use Planet's data to develop new...
remote Spain full-time 2w ago
pythonawsgcpazurekubernetesterraformansiblecloudflare +2
Show description
Why should you join dLocal? dLocal enables the biggest companies in the world to collect payments in 40 countries in emerging markets. Global brands rely on us to increase conversion rates and simplify payment expansion effortlessly. As both a payments processor and a merchant of record where we operate, we make it possible for our merchants to make inroads into the world’s fastest-growing, emerging markets. By joining us you will be a part of an amazing global team that makes it all happen. Bei...
GBP 98k-138k/yr remote UK full-time 2w ago
pythonkotlinmysqlawskubernetes
Show description
Affirm is reinventing credit to make it more honest and friendly, giving consumers the flexibility to buy now and pay later without any hidden fees or compounding interest. Affirm is reinventing credit to make it more honest and friendly, giving consumers the flexibility to buy now and pay later without any hidden fees or compounding interest. About the team The Consumer Payments team at Affirm owns systems handling billions of Dollars worth of transactions each year. You will work at scale to s...
remote UK full-time 2w ago
kotlinandroidjetpackgraphql
Show description
About Tripadvisor The Tripadvisor Group connects people to experiences worth sharing, and aims to be the world’s most trusted source for travel and experiences. We leverage our brands, technology, and capabilities to connect our global audience with partners through rich content, travel guidance, and two-sided marketplaces for experiences, accommodations, restaurants, and other travel categories. The subsidiaries of Tripadvisor, Inc. (Nasdaq: TRIP), include a portfolio of travel brands and busin...
remote Ukraine full-time 2w ago
javascriptreactvueangularnodejsexpressmysqlmongodb +2
Show description
We are looking for a Software Engineer with strong backend expertise to strengthen our engineering team at a successful web project from the USA. As a Software Engineer , you will contribute to building and enhancing the platform within a collaborative engineering team. While the current stack includes Angular and Node.js , the strategic goal is to expand backend capabilities and strengthen collaboration with engineering and ETL teams . Depending on project priorities, you may initially focus on...
remote Americas, Europe, Asia, Oceania full-time 3w ago
javascriptpythonrustgojavaphpreactvue +22
Show description
Are you a talented Senior Data Engineer looking for a remote job that lets you show your skills and get decent compensation? Look no further than Lemon.io — the marketplace that connects you with hand-picked startups in the US and Europe. What we offer: The rate depends on your skills and experience. We've already paid out over $11M to our engineers. No more hunting for clients or negotiating rates — let us handle the business side of things so you can focus on what you do best. We'll manually f...
remote Remote full-time 3w ago
javascalareactawsgcpazureoauth
Show description
Headquarters: Remote, Ontario, Canada We’re not just building better tech. We’re rewriting how data moves and what the world can do with it. With Confluent, data doesn’t sit still. Our platform puts information in motion, streaming in near real-time so companies can react faster, build smarter, and deliver experiences as dynamic as the world around them.It takes a certain kind of person to join this team. Those who ask hard questions, give honest feedback, and show up for each other. No egos, no...
remote Remote full-time 3w ago
azuredockerkubernetesterraformgithub-actionsgitlab
Show description
Headquarters: Warsaw, 14, Poland Job descriptionAs a DevOps Engineer at Digital Forms, you’ll work at the heart of our digital transformation projects - designing robust infrastructure, shaping CI/CD pipelines, and ensuring smooth delivery of products used by companies around the world.This role blends technical depth with a consulting approach. You will collaborate directly with clients, understand their operational challenges, and translate them into practical, secure, and maintainable DevOps ...
remote Remote full-time 3w ago
javaazuredockerkubernetesansiblejenkinsprometheusgrafana +2
Show description
Headquarters: Thessaloniki, Central Macedonia, Greece Are you a skilled DevOps Engineer looking to make an impact? We have an exciting opportunity for you to join our expanding development team in Thessaloniki or work fully remotely. Be part of a dynamic and innovative environment where your expertise will drive success in cutting-edge projects.What You'll Do: Maintain and develop CI/CD pipelines and automated processes; Maintain and enhance containerized microservice architectures hosted on Kub...
USD 312-52/yr remote Worldwide full-time 3w ago
Show description
WHY YOU SHOULD APPLY: Coalition Technologies is devoted to delivering clients the highest quality work while providing our team a fun, thriving, and innovative environment. Along with the opportunity for tremendous career growth and rapid advancement, CT offers: The most competitive profit-sharing bonus plan in the industry, paying up to 50% of company profits to full-time employees each month! A highly competitive Paid Time Off plan, promoting quality work-life balance. Subsidized gym membershi...
remote LATAM, Canada, Netherlands, UK, USA full-time 3w ago
pythonrubyrailspostgresqlgitlabllmrspecgraphql
Show description
GitLab is the intelligent orchestration platform for DevSecOps. GitLab enables organizations to increase developer productivity, improve operational efficiency, reduce security and compliance risk, and accelerate digital transformation. More than 50 million registered users and more than 50% of the Fortune 100* trust GitLab to ship better, more secure software faster. The same principles built into our products are reflected in how our team works: we embrace AI as a core productivity multiplier,...
remote Argentina full-time 3w ago
javascripttypescriptpythonreactangularnodejsaws
Show description
Caylent is a cloud native services company that helps organizations bring the best out of their people and technology using Amazon Web Services (AWS). We provide a full-range of AWS services including workload migrations and modernization, cloud native application development, DevOps, data engineering, security and compliance, and everything in between. At Caylent, our people always come first. We are a global company and operate fully remote with employees in Canada, the United States, and Lati...
remote Japan full-time 3w ago
llm
Show description
About the role: Gartner Analysts are industry thought leaders who create must-have research, make market predictions and identify best practices for a broad range of world-leading organizations. A Senior Director serves as a leader within Gartner’s Business Technology Insights (BTI) sector, establishing oneself as a credible voice within their designated domain at local, regional and global levels. Utilizing exceptional research and analytical skills, a Senior Director plays a key role in produc...
remote Australia full-time 3w ago
kubernetesansiblellmmachine-learninglinux
Show description
NVIDIA has been transforming computer graphics, PC gaming, and accelerated computing for more than 25 years. It’s a unique legacy of innovation that’s fueled by great technology—and amazing people. Today, we’re tapping into the unlimited potential of AI to define the next era of computing. An era in which our GPU acts as the brains of computers, robots, and self-driving cars that can understand the world. Doing what’s never been done before takes vision, innovation, and the world’s best talent. ...
remote Ukraine full-time 3w ago
javascripttypescriptjavareactangularnodejsawsreact-native +2
Show description
We are looking for a strong Middle React Native Developer with 3+ years of experience to develop and maintain an IoT-based mobile application. Requirements Must have: 3+ years of commercial experience in mobile development with a strong focus on React Native Strong knowledge of JavaScript (ES6+) and TypeScript, including modern React patterns and Hooks Hands-on experience with Expo, React Navigation, and state management libraries such as Redux, MobX, or Context API Experience working with REST ...
remote Europe full-time 3w ago
typescriptpythongitlabplaywrightseleniumrestgit
Show description
About Smartcat Smartcat is building the future of work, where human expertise meets digital teammates to drive 10x to 1000x productivity gains for the world’s leading enterprises. We’re on the frontier of an entirely new category: Agentic AI. We enable enterprises to build high-performing hybrid workforces made up of both humans and AI agents. These AI agents aren’t generic copilots. They’re fully trained digital teammates that learn from your best people, your content, and your business strateg...
USD 200/yr remote Europe full-time 3w ago
kotliniosandroidjetpack
Show description
About ToptalToptal is a global network of top talent in business, design, and technology that enables companies to scale their teams, on-demand. With $200+ million in annual revenue and team members based around the globe, Toptal is the world’s largest fully remote workforce.We take the best elements of virtual teams and combine them with a support structure that encourages innovation, social interaction, and fun. We see no borders, move at a fast pace, and are never afraid to break the mold.Job...
remote Denmark, Germany, Netherlands, UK full-time 3w ago
awsgcpazureapachesparkdatabricks
Show description
RDQ127R264 This role is open to remote candidates within the Europe, with a preference for those based in London, Netherlands, Germarny or Denmark. Databricks is seeking an exceptional and strategic Sr. Staff Security Engineer, Incident Response to join our Incident Response team. This pivotal role will provide decisions that have a direct impact on the long-term success of Databricks' security posture, creating solutions that enable potential future opportunities without a known path. You will ...
USD 45k-75k/yr remote Serbia full-time 3w ago
javascripttypescriptnodejsexpressnestjspostgresqlmysqlmongodb +12
Show description
Senior Back-end/API Developer (Node/Express.js) Location: Remote - Balkan Region, Latin America, and Mexico (location restrictions apply) About Worldly Worldly is the world’s most comprehensive impact intelligence platform — delivering real data to businesses on impacts within their supply chain. Worldly is trusted by 40,000 global brands, retailers, and manufacturers to provide the single source of ESG intelligence they need to accelerate business and industry transformation. Through strategic ...
USD 33/hr remote Poland full-time 3w ago
pythonpandasnumpy
Show description
Please submit your CV in English and indicate your level of English proficiency. Mindrift connects specialists with project-based AI opportunities for leading tech companies, focused on testing, evaluating, and improving AI systems. Participation isproject-based, not permanent employment. What this opportunity involves While each project involves unique tasks, contributors may: Design rigorous electrical engineering problems reflecting professional practice. Evaluate AI solutions for correctness...
remote Remote full-time 3w ago
javascriptpythonnodejspostgresqlawsgcpdockerkubernetes +5
Show description
Headquarters: United States About NickAINickAI is revolutionizing cryptocurrency investing through AI-powered autonomous trading agents. Our platform enables users to create sophisticated AI agents that manage crypto portfolios 24/7, eliminating emotional trading decisions and maximizing investment opportunities.During our beta phase, we've successfully managed over $500,000 in assets and are rapidly expanding our platform to serve both retail and institutional investors. Our mission is to democ...
remote Remote full-time 3w ago
javascriptpythonreactnextjsdjangopostgresqlawsgcp +3
Show description
Headquarters: 11 Irving Place, #09-01, Singapore, 369551 Singapore Experience: 3–6+ yearsRole OverviewWe are looking for experienced Full Stack Developers to join a product-focused engineering team building modern, scalable web platforms. You will work across backend APIs, frontend applications, and cloud-native infrastructure.Key ResponsibilitiesDesign and develop backend services using Python & DjangoBuild modern, responsive frontend applications using Next.js (React)Work with containerized ap...
remote Remote full-time 3w ago
javagcpdockerkubernetesterraformansiblegitlablinux +1
Show description
Headquarters: Bucharest Romania ABOUT COMPANY Oben stands ready to provide the IT Strategy and Consulting support for Global Leaders to help them steer their Organizations through Change. We leverage our functional and technology expertise, insights and industry know-how to help Enterprises reach their goals. ROLE INSIGHTS You are passionate about digital products and have a strong ability to solve technical and architectural IT problems. If you are interested in discussing such an opportunity w...
USD 60-130/yr remote USA full-time 3w ago
swiftiosswiftuirestfigmagit
Show description
WHO ARE WE? At nooro, we're revolutionizing pain management for seniors. Our platform is transforming how older adults engage with pain management at home. We're on a mission to make wellness more accessible and effective through technology. Check our website here: https://nooro-us.com/ We're a fast-moving startup that works on quick iteration and bold decisions. Our team is lean, agile, and empowered to make meaningful impacts daily. If you enjoy a dynamic environment where ideas become a reali...
remote Remote full-time 3w ago
awsdockerkubernetesterraformansiblejenkinsgithub-actionscircleci +4
Show description
Headquarters: New York, New York, United States Job descriptionM0 is a stablecoin platform for builders. With M0, developers can create their stablecoins in minutes by extending $M - M0’s superior digital-dollar building block, and customize attributes such as branding, compliance behaviors, and yield distribution mechanics. By extending $M into their own stablecoin, businesses can monetize their digital dollar use cases and maintain control over their money tech stack, while not being burdened ...
remote Remote full-time 3w ago
azurekubernetespulumiargocd
Show description
Headquarters: Montréal, Quebec, Canada Akinox s’engage à être un véritable agent de changement. Nous cherchons à faire une réelle différence dans la vie des gens à l’aide de solutions numériques modernes permettant des soins accessibles, efficaces, collaboratifs et centrés sur le patient. Nous connaissons la puissance de l'innovation et nous sommes déterminés à l’utiliser pour moderniser les systèmes de soins de santé!️Travail à distance: Comme tu seras en télétravail en permanence, tu pourras t...
remote Remote full-time 3w ago
pythonjavakotlinawsgcpazurellmunix
Show description
Headquarters: Paphos, Cyprus JetBrains is a well-known international software development company. Ever since we started, back in 2000, we’ve strived to make the strongest, most effective developer tools on earth. Our products are used by more than 15 million users worldwide, and 88 Fortune Global 100 companies are our customers.We are seeking an experienced and talented Security Engineer to join the Product Security team and help safeguard JetBrains products and services. In this role, you will...
remote Netherlands full-time 3w ago
awsgcpazurekubernetesterraformansibleprometheusgrafana
Show description
At Catawiki, every day brings the extraordinary! Whether it’s Daniel Ricciardo’s Formula 1 Car , a Woolly Mammoth’s Skeleton , Lady Gaga's Jumpsuit or Usain Bolt’s running shoe , we encounter exceptional objects every day. We’re a one-of-a-kind marketplace for buying and selling special objects. Each week, more than 110,000 unique items are auctioned, all carefully curated by our passionate in-house experts. Having sold over 25 million unique objects, our mission is to become the world’s most po...
GBP 48k-75k/yr remote UK full-time 3w ago
spark
Show description
Looking to make a real impact? Our Internal Systems team plays a critical role behind the scenes, building and supporting the NetSuite platform that keeps our Finance and Sales teams running smoothly. This is a chance to take real ownership, bring new ideas to life, and build smart, scalable solutions. With a small, agile team around you, there's plenty of room to innovate, automate, and truly make your mark. What you'll be doing As a NetSuite Developer, you'll support and enhance our corporate ...
remote Poland full-time 3w ago
javascripttypescriptpythonvuedjangoaws
Show description
About the Company: UN reports estimate the world will not have enough food by 2050 due to increased population and land limitations. The food and agriculture industries are adjusting and trying to become more efficient and increase yield. But it all starts with the seeds. At Seed-X, we are using deep learning and computer vision, and building seed sorting platforms in order to revolutionize the seed/plant breeding industry, which is in a never ending pursuit of developing new superior varieties,...
USD 25-35/yr remote Worldwide full-time 3w ago
Show description
About Us We are a financial services start up focusing on helping to improve consumer credit profiles. We are currently seeking KPI driven sales representatives looking to earn up to 45K in their first year while working remotely. We offer comprehensive training and continuous sales coaching to help you meet your financial goals. During our training period we offer a guaranteed training stipend while our trainees are acclimating to the position (*see weekly pay below). If you are a seasoned sale...
remote Remote full-time 3w ago
pythonawsdockerkubernetesbash
Show description
Headquarters: United States Who We AreTetraScience is the Scientific Data and AI company. We are catalyzing the Scientific AI revolution by designing and industrializing AI-native scientific data sets, which we bring to life in a growing suite of next-gen lab data management solutions, scientific use cases, and AI-enabled outcomes. TetraScience is the category leader in this vital new market, generating more revenue than all other companies in the aggregate. In the last year alone, the world’s d...
remote Remote full-time 3w ago
javascripttypescriptgonodejsazuredockerkubernetesterraform +2
Show description
Headquarters: Brazil We are seeking a highly skilled and motivated Senior DevOps Go Developer to join our Platform Engineering team. This pivotal role focuses on architecting, developing, and refining Go-based Kubernetes controllers and operators to advance our internal GitOps-driven Kubernetes hosting platform. The ideal candidate will play a critical role in automating infrastructure and platform operations, integrating tightly with GitHub, and driving best practices in testing and observabili...
remote Remote full-time 3w ago
pythonawsdockerkubernetesterraformprometheusgrafanamachine-learning +5
Show description
Headquarters: Santiago de Chile / Concepción / Talca / Valparaíso / Lima / Arequipa / Bogotá Sobre CoderioCoderio diseña y entrega soluciones digitales escalables para empresas globales. Con una base técnica sólida y una mentalidad orientada al producto, nuestros equipos lideran proyectos de software complejos desde la arquitectura hasta la ejecución. Valoramos la autonomía, la comunicación clara y la excelencia técnica. Colaboramos estrechamente con equipos y socios internacionales, construyend...
remote Remote full-time 3w ago
pythonawsgcpazuredockerkubernetesterraformansible +3
Show description
Headquarters: Makati Metro Manila Philippines Position: Lead Azure DevOps Engineer | RemoteSchedule: Midshift (5 p.m. to 2 a.m.) Job Highlights:Our primary focus is on Azure technology, offering numerous exciting opportunities to develop your skills within the Microsoft and Azure ecosystems. Working with us means being part of a team dedicated to technical excellence and delivering exceptional client experiences in a specialized, well-defined area. Just six months on our team can be equivalent t...
remote Remote full-time 3w ago
pythonjavakotlinreactpostgresqlawsdockerrest
Show description
Headquarters: Newcastle upon Tyne, England, United Kingdom Important NoteRight now we’re prioritising coaches who are expert in Go or Domain-Driven Design.If you have expertise in other technologies, then please do still apply. In this case, we may ask to keep your details and reach out when we are more confident of demand in those areas.Role SummaryWe’re looking for experienced lead engineers or equivalent to lead targeted micro-workshops for small groups of software engineers. The sessions las...
remote Remote full-time 3w ago
pythonpytest
Show description
Headquarters: Remote About Grey chain (https://greychaindesign.com/)A Generative AI-as-a-service, Mobile & Digital Transformation firm helping organizations reimagine user experiences with Disruptive & Transformational thinking and partnership. Trusted by: UNICEF, BOSE, KFINTECH, WHO and many Fortune 500 CompaniesHome of over 110 Product Engineering nerds building the next generation of Digital Products.Primary Industries: Banking & Financial Services, Non-Profits, Retail & eCommerce, Consumer G...
remote Remote full-time 3w ago
pythonrubymysqlrediscassandraawsansiblegithub-actions +3
Show description
Headquarters: Czech Republic Who are we looking for?We’re looking for more than just an infrastructure guru. We want a DevOps powerhouse with solid AWS expertise – who also brings something extra to the table. Maybe you’re a part-time data scientist, a seasoned backend coder, or you geek out on dashboards and data visualization. If you’re as comfortable optimizing CI/CD pipelines as you are building data pipelines or coding microservices, then let’s talk.This role is your chance to leave a mark ...
remote Netherlands full-time 3w ago
kubernetesterraform
Show description
Upbound is redefining how modern infrastructure is built for the Agentic AI Era. We’re the creators and primary maintainers of Crossplane , and we’re building the Intelligent Control Plane —a new platform layer that makes infrastructure programmable, autonomous, and composable . Our mission is to power the AI-native enterprise with a foundational platform layer that helps teams provision, operate, and adapt infrastructure at scale—so platforms are ready for both humans and AI agents . We partner...
USD 130k-160k/yr remote EMEA full-time 3w ago
awsllm
Show description
As a Security Engineer at Exodus, you will play a critical role in strengthening the security and resilience of our platform by engineering scalable defensive systems across enterprise and production environments, with detection and response as core capabilities. This role goes beyond traditional monitoring, you will design and implement scalable automation that empowers our Cyber Defense team to detect, triage, and respond to threats more effectively. By leveraging both AI-assisted and traditio...
USD 98k-210k/yr remote Canada, Israel, Netherlands, USA full-time 3w ago
typescriptrustrubyvuerailsclickhousegitlabkafka +1
Show description
GitLab is the intelligent orchestration platform for DevSecOps. GitLab enables organizations to increase developer productivity, improve operational efficiency, reduce security and compliance risk, and accelerate digital transformation. More than 50 million registered users and more than 50% of the Fortune 100* trust GitLab to ship better, more secure software faster. The same principles built into our products are reflected in how our team works: we embrace AI as a core productivity multiplier,...
remote Germany full-time 3w ago
awskubernetesterraform
Show description
Upbound is redefining how modern infrastructure is built for the Agentic AI Era. We’re the creators and primary maintainers of Crossplane , and we’re building the Intelligent Control Plane —a new platform layer that makes infrastructure programmable, autonomous, and composable . Our mission is to power the AI-native enterprise with a foundational platform layer that helps teams provision, operate, and adapt infrastructure at scale—so platforms are ready for both humans and AI agents . We partner...
remote Remote full-time 3w ago
dockerkubernetes
Show description
Headquarters: 34 Av. de l'Opéra, 75002 Paris, France Description de l'entrepriseOCTOPremier cabinet d’architectes IT fondé en 1998, pionnier du delivery agile et véritable concentrateur de talents. Nous incarnons les nouvelles façons de faire du conseil et du Delivery. Digital Doers & Thinkers est notre marque de fabrique. Nous privilégions aujourd'hui notre positionnement Agile & DeepTech et sommes engagés quant à notre responsabilité sociale et environnementale.Description du posteLe Why du st...
remote Remote full-time 3w ago
javascriptphpreactvuegit
Show description
Headquarters: Paderborn, NW, 33100 Germany Job descriptionDu bist nicht der typische Full Stack Developer? Wir suchen einen Developer, der transparente Kommunikation, sauberes Coding und qualitativ hochwertige Arbeit nicht nur als Floskel verwendet.Das „montagmorgens“-Gefühl gibt es bei uns nicht:Bei uns darfst Du so sein, wie Du wirklich bist! Koro, Zalando, FC Moto, Wöhrl – Abwechslungsreiche Aufgaben und ProjekteWir leben Feedback und fördern dies!Von Bahncard bis WalkingPad – wir lieben indi...
remote Remote full-time 3w ago
pythongcpkubernetesterraformjenkinsgitlabhelmargocd +5
Show description
Headquarters: Netanya, Center District, Israel Fetcherr experts in deep learning, e-commerce, and digitization, Fetcherr disrupts traditional systems with its cutting-edge AI technology. At its core is the Large Market Model (LMM), an adaptable AI engine that forecasts demand and market trends with precision, empowering real-time decision-making. Specializing initially in the airline industry, Fetcherr aims to revolutionize industries with dynamic AI-driven solutions.We are looking for a DevOps ...
remote Remote full-time 3w ago
javascriptdockergithub-actionsblockchainlinux
Show description
Headquarters: London, ENG, United Kingdom Job descriptionJoin Tether and Shape the Future of Digital FinanceAt Tether, we’re not just building products, we’re pioneering a global financial revolution. Our cutting-edge solutions empower businesses—from exchanges and wallets to payment processors and ATMs—to seamlessly integrate reserve-backed tokens across blockchains. By harnessing the power of blockchain technology, Tether enables you to store, send, and receive digital tokens instantly, secure...
remote Remote full-time 3w ago
javascripttypescriptphpreactlaravelmysqldockerterraform +1
Show description
Headquarters: Bari, Italia Descrizione dell'aziendaVuoi lavorare su un prodotto che migliora davvero la vita delle persone?In Ninacare stiamo costruendo il primo HR-tech italiano dedicato al settore sanitario, aiutando migliaia di professionisti sanitari a trovare il lavoro giusto e le strutture sanitarie a trovare professionisti qualificati.Con oltre 16.000 professionisti iscritti, un'integrazione diretta con Indeed ed altre job platform, e un motore di matching basato su AI, stiamo rivoluziona...
remote Remote full-time 3w ago
elixir
Show description
Headquarters: San Francisco, CA We are seeking a Notice Content Migration & Redesign Specialist with expertise in OpenText Exstream to support the migration of taxpayer correspondence from legacy platforms and to lead the redesign of notices, letters, and forms. The ideal candidate will work closely with cross-functional teams, including Taxpayer Correspondence Services (TCS), IT, and business stakeholders, to modernize and improve the effectiveness of outbound communication. Migration Duties: M...
remote Remote full-time 3w ago
javascriptphpreactvuegit
Show description
Headquarters: Köln, NW, Germany Job descriptionDu bist nicht der typische Full Stack Developer? Wir suchen einen Developer, der transparente Kommunikation, sauberes Coding und qualitativ hochwertige Arbeit nicht nur als Floskel verwendet.Das „montagmorgens“-Gefühl gibt es bei uns nicht:Bei uns darfst Du so sein, wie Du wirklich bist! Koro, Zalando, FC Moto, Wöhrl – Abwechslungsreiche Aufgaben und ProjekteWir leben Feedback und fördern dies!Von Bahncard bis WalkingPad – wir lieben individuelle Zi...
remote Remote full-time 3w ago
Show description
Headquarters: Remote, VOV, Belgium Job description We’re taking on the crusty global cyber market, the "no-bullsh*t" sec platform for devs.In the past, only large enterprises needed to worry about security. Today, every startup holds significant customer data, and cybersecurity has become the top concern of 75% of all CEOs.This means all developers need to ensure their platforms are secure, but the market is riddled with overcomplicated, expensive tools that aren’t fit for purpose. We are a no-B...
remote Remote full-time 3w ago
javascripttypescriptrustgojavareactvuenextjs +15
Show description
Headquarters: Hong Kong We are hiring for one of our ecosystem projects in Web3. As a Web3 Full Stack Developer, you will design, develop, and maintain decentralized applications (dApps) and blockchain-based systems. You will work across the full stack, from smart contract development to front-end interfaces, collaborating with cross-functional teams to deliver secure, scalable, and user-friendly Web3 solutions. Your expertise in Web3 protocols and modern tech stacks will be critical to building...
remote Remote full-time 3w ago
javareactspringawsazuredocker
Show description
Headquarters: Remoto Descripción del puesto / Funciones¿Eres un/a desarrollador/a Full Stack con pasión por la innovación y la escalabilidad? ¡Esta es tu oportunidad! Estamos buscando un perfil versátil para unirse a un proyecto internacional del sector eCommerce, desarrollando soluciones digitales de alto impacto.Requisitos mínimos+3 años de experiencia profesional como desarrollador/a full stack.Desarrollar y mantener aplicaciones full stack escalables y de alto rendimiento.Construir servicios...
remote Remote full-time 3w ago
pythonperl
Show description
Headquarters: Hyderabad, India Company DescriptionRenesas is one of the top global semiconductor companies in the world. We strive to develop a safer, healthier, greener, and smarter world, and our goal is to make every endpoint intelligent by offering product solutions in the automotive, industrial, infrastructure and IoT markets. Our robust product portfolio includes world leading MCUs, SoCs, Analog and power products, plus Winning Combination solutions that curate these complementary products...
remote Remote full-time 3w ago
javascriptreactangularjqueryazure
Show description
Headquarters: Costa Rica (Remote) The Company Serving the People Who Serve the People Granicus is driven by the excitement of building, implementing, and maintaining technology that is transforming the Govtech industry by bringing governments and their constituents together. We are on a mission to support our customers by meeting the needs of their communities and implementing our technology in ways that are equitable and inclusive. Granicus has consistently appeared on the GovTech 100 list over...
remote Remote full-time 3w ago
pythonnodejskubernetesterraformansiblemachine-learninglinuxbash
Show description
Headquarters: Selector is building an operational intelligence platform for digital infrastructure. By adopting an AI/ML based analytics approach, the platform provides actionable multi-dimensional insights to network, cloud and application operators. It enables operations teams to meet their KPIs through seamless collaboration, search-driven conversational user experience and automated data engineering pipelines.We're seeking a highly motivated DevOps/SRE to join our growing team and play a piv...
USD 142k-159k/yr remote Canada full-time 3w ago
swiftiosrest
Show description
About Us: Ground News is a platform that makes it easy to compare news sources, read between the lines of media bias and break free from algorithms. In a world where political polarization and media distrust are at an all-time high, Ground News offers people a better way to stay informed and see every side of the story. Our mobile app, web app, and browser extension are home to a community of mindful readers who use our news comparison platform to engage with news beyond their filter bubble. Unl...
remote Costa Rica full-time 3w ago
postgresqlawsdocker
Show description
Company Description Experian is a global data and technology company, powering opportunities for people and businesses around the world. We help to redefine lending practices, uncover and prevent fraud, simplify healthcare, create digital marketing solutions, and gain deeper insights into the automotive market, all using our unique combination of data, analytics and software. We also assist millions of people to realise their financial goals and help them to save time and money. We operate acros...
remote Mexico full-time 3w ago
javascripttypescriptpythonnodejsdynamodbawsterraformrest
Show description
At Varicent, we’re not just transforming the Sales Performance Management (SPM) market—we’re redefining how organizations achieve revenue success. Our cutting-edge SaaS solutions empower revenue leaders globally to design smarter go-to-market strategies, maximize seller performance, and unlock untapped potential. Varicent stands at the forefront of innovation, celebrated as a market leader in the 2025 Forrester Wave Report for SPM , 2023 Ventana Research Revenue Performance Management (RPM) Valu...
remote USA full-time 3w ago
javascriptreactvueangular
Show description
Meta Platforms, Inc. (Meta), formerly known as Facebook Inc., builds technologies that help people connect, find communities, and grow businesses. When Facebook launched in 2004, it changed the way people connect. Apps and services like Messenger, Instagram, and WhatsApp further empowered billions around the world. Now, Meta is moving beyond 2D screens toward immersive experiences like augmented and virtual reality to help build the next evolution in social technology. To apply, click “Apply to ...
remote Americas, Europe, Asia, Oceania - with exceptions full-time 3w ago
javascripttypescriptpythonrustgojavaphpreact +16
Show description
Are you a talented Senior Developer looking for a remote job that lets you show your skills and get decent compensation? Look no further than Lemon.io — the marketplace that connects you with hand-picked startups in the US and Europe. What we offer: The rate depends on your seniority level, skills and experience. We've already paid out over $11M to our engineers. No more hunting for clients or negotiating rates — let us handle the business side of things so you can focus on what you do best. We'...
remote Remote full-time 4w ago
pythonjavamysqlawsdockerkubernetesgithub-actionsandroid +2
Show description
Headquarters: Cambourne, United Kingdom Of Great Britain And Northern Ireland About the Role: We are looking for a DevOps & QA Automation Engineer to join our team during a pivotal architectural transformation. You will be directly responsible for building and maintaining robust CI/CD pipelines, integrating automated testing and validation, and driving best practices in release governance and infrastructure automation. As we migrate from a fragmented set of tools to a productised platform, your ...
remote Remote full-time 4w ago
linux
Show description
Headquarters: Manchester, United Kingdom Infrastructure Developers take a multifaceted approach to helping clients achieve technical excellence by assessing challenges from both a technical and operational perspective. As consummate ‘bringers of knowledge,' they take extra care to ensure their team and client understand operational requirements and take a shared responsibility for designing and implementing infrastructure that delivers and runs software services. They also help customers adopt a...
remote Remote full-time 4w ago
figma
Show description
Headquarters: , None, Philippines Location: Remote Job Type: Full-TimeAbout the Role We are seeking a detail-oriented Product Merchandising Specialist to join our team and play a key role in optimizing our online store on Shopify. This position is perfect for someone who thrives at the intersection of visual storytelling, data-driven decision-making, and seamless user experience.In this role, you'll be responsible for maximizing product visibility, refining collection and homepage merchandising,...
remote Remote full-time 4w ago
Show description
Headquarters: London The OpportunityThe Product Knowledge Lead, Internally titled Business Systems Analyst isn't your average "IT Analyst" role. We're looking for a visionary “IT Analyst” who will be the driving force behind product proficiency and adoption within Sitetracker's dynamic Research and Development (R&D) organization. In this role, You will be a proactive enablement leader and a deep subject matter expert, moving beyond traditional documentation to strategically equip our R&D team an...
GBP 85k-90k/yr remote Remote full-time 4w ago
awsjenkinsgithub-actionscircleci
Show description
Headquarters: Edinburgh, Midlothian Lead DevOps Engineer - AWS Edinburgh (Remote first) £85,000 - £90,000 My client, a leading software company is looking to hire an experienced Lead DevOps Engineer to support their R&D department as well as the deployment and maintenance of their SaaS product. Leading a small team, you will be responsible for Developer Experience systems, enhancing collaboration, automating workflows and accelerate delivery cycles whilst fostering a culture of cloud excellence....
remote Remote full-time 4w ago
ios
Show description
Headquarters: France - Remote At HCL Software, we are driven by innovation. With decades of experience as industry leaders, we power critical sectors such as finance, telecommunications, and scientific research across the globe. As a fast-growing $2B business, our portfolio spans over 20 product families across Customer Experience, Digital Solutions, Secure DevOps, and Security and Automation.We’re on an ambitious journey to become the #1 software company in the world. Join us and make a meaning...
remote Remote full-time 4w ago
pythonpostgresqlmongodbredisawsgcpazuredocker +11
Show description
Headquarters: Poland About CorvaCorva has built a first-of-its-kind energy app store on a bedrock of best-in-class technologies, data pipelines, and a secure and scalable architecture. Our energy solutions solve today's toughest well delivery challenges, from well design through drillout. The ever-evolving platform is not only future-proof for digitizing operations but is your toolkit to accelerate sustainability and energy transition goals. Our platform is built for speed and reliability and de...
USD 4-5/yr remote Remote full-time 4w ago
Show description
Headquarters: Cebu, Cebu Overview: We are seeking a highly organized and detail-oriented Product Information Management (PIM) Specialist to assist in the management, transformation, and syndication of product data across various platforms. The ideal candidate will work closely with the Systems Administrator to support product data entry, ensure information completeness, and handle syndication across customer channels and platforms, such as Salsify and Amazon Vendor Central. A solid understanding...
remote Remote full-time 4w ago
javascripttypescriptc++scalareactvueangularpostgresql +11
Show description
Headquarters: Rome, LAZIO, Italy Chi siamo:Selefor è tra i principali riferimenti italiani per consulenza HR specializzata, formazione tecnica avanzata e progettualità in ambito digitale. Valorizziamo diversità, inclusione e accessibilità, impegnandoci per una crescita continua delle competenze tecnologiche all’interno delle organizzazioni.Per una realtà di rilievo nazionale nell’innovazione software, ricerchiamo una/un Senior Full Stack Developer C++ con passione per la guida di team, la proget...
remote Remote full-time 4w ago
javascriptnodejsmysqlmongodbaws
Show description
Headquarters: PT-Remote,PT-Faro You like problem solving, both via programmatically but also via data analysis? You are interested in being part of a key component in Contentserv’s Cloud Product portfolio? You want to be part of a technology leader in marketing software solutions including MDM (Master Data Management), PIM (Product Information Management) and DAM (Digital Asset Management)? For our further growth we are looking for people who will help shape the future of Contentserv. People who...
remote Remote full-time 4w ago
pythonkubernetesansiblehelmprometheuslinux
Show description
Headquarters: Version FrançaiseNous recherchons une forte expérience en technologies Linux et cloud. Dans ce rôle, vous soutiendrez non seulement nos clients utilisant Atmosphere, notre produit cloud open-source, mais vous fournirez également un soutien essentiel à notre équipe interne de CloudOps qui gère notre infrastructure cloud publique et privée.Ce rôle est une opportunité passionnante pour ceux qui ont une passion pour le développement open-source et la technologie de rejoindre l'équipe A...
EUR 6-7/yr remote Remote full-time 4w ago
Show description
Headquarters: Barcelona (ES Cal),Remote Hector Kitchen is a pioneering company in pet nutrition, dedicated to providing high-quality products for the well-being of pets. As part of our expansion, we're looking for a Full Stack Developer enthusiast ready to actively contribute to structuring our tech team and developing new features in line with our roadmap.Join us on a journey to shape the future of pet care with your tech skills! You’ll be working within a multi-platform ecosystem of four compa...
remote Remote full-time 4w ago
javascriptphpreactvuelaravelmysqldockersentry +2
Show description
Headquarters: Georgia (remote) Get to know us:BOLD & EPIC Craft - the new work network challenges the status quo of the working world. We believe in our colleagues. And that only happy people do great work. We don't care when and where. We want to create a place where everyone enjoys creating.Culture:At BOLD & EPIC Craft our success is powered by people. Our culture is what makes BOLD & EPIC Craft a rewarding place to work. We look at each and every person as a vital member of the team. BOLD & E...
remote Remote full-time 4w ago
typescriptpythonawsterraformpulumi
Show description
Headquarters: Remote (RS),Novi Sad Welcome to Auvaria, where passion, team spirit, responsibility and courage form the basis of our culture.We are looking for a motivated and solution-oriented team player (f/m/d) with a flair for individual customer requirements and a strong hands-on mentality. As a Senior Cloud Consultant - DevOps, you will play an important role in the implementation of complex cloud projects and take responsibility for the technical architecture and implementation of cloud so...
remote Remote full-time 4w ago
javaawsgcpazuredockerkubernetesterraformansible +4
Show description
Headquarters: Remote,München Einleitung Wir suchen nach einem erfahrenden DevOps Engineer/Developer mit umfangreicher Java-Expertise. Wenn Sie Ihre Fähigkeiten in einem hochinnovativen Umfeld einsetzen möchten und denken, dass Sie die Zukunft der IT mitgestalten können, sollten Sie sich bewerben! Deine AufgabenVerantwortung für den gesamten Lebenszyklus unserer Java-basierten Anwendungen – von der Entwicklung über das Deployment bis hin zur Wartung in der Produktionsumgebung.Entwicklung und Betr...
USD 167k-208k/yr remote Remote full-time 4w ago
haskell
Show description
Headquarters: San Francisco, CA, New York, NY, Portland, OR, or Remote within Canada or United States Since the dawn of aviation, pilots have faced the constant challenge of air resistance, much like sailors navigating the friction of water. Amidst this relentless struggle, the trim tab emerges as an ingenious yet understated marvel. Just as the wheel revolutionized transportation by easing movement over land, the trim tab simplifies flight, allowing for smoother navigation through the skies. It...
remote Remote full-time 4w ago
gonodejspostgresqlmongodbredisawsgcpazure +3
Show description
Headquarters: London GB Companion Group is a AAA co-development gaming studio with a globally distributed and fully remote setup, renowned for its adeptness in overcoming the most intricate challenges in multiplayer game development. Our reputation precedes us as an excellent choice for clients aspiring to elevate their latest multiplayer titles, enabling scalability in player numbers, maximising player density, and crafting immersive gameplay experiences. Embedded seamlessly within a client's i...
remote Remote full-time 4w ago
awsgcpazuredockerkubernetesterraformansiblejenkins +7
Show description
Headquarters: Melbourne VIC Australia We are looking for a passionate and detail-oriented DevOps Engineer Intern to join our technology team. As a DevOps intern, you will gain hands-on experience with cloud infrastructure, CI/CD pipelines, automation tools, and system monitoring, supporting our efforts to streamline development and deployment processes. Freelancer Prox is the first platform to provide a fully cost-free experience for both recruiters and job seekers. By creating a professional pr...
remote Remote full-time 4w ago
pythonawsgcpazuredockerkubernetesjenkinsgithub-actions +1
Show description
Headquarters: Remoto Acelera tu carrera en Interinnova. ¡Aplica ahora y te contactaremos!Requisitos- Graduado/a o estudiante avanzado/a de carreras de Sistemas, Ingenierías o afines.- Experiencia mínima de 4 años en roles similares dentro de IT.- Contar con skills DevOps - Residir en Argentina.¿Qué esperamos de vos?Tu rol va a ser clave en el diseño de APIs y la lógica de orquestación para sistemas distribuidos. Conocimientos excluyentes- Python- Infraestructura en la nube (AWS, GCP o Azure)- CI...
remote Remote full-time 4w ago
flutter
Show description
Headquarters: New Delhi About Restat & TallyAssistRestat is helping small businesses scale by providing products and services that help them become data-driven. Our first product, TallyAssist, is a smart business assistant application that connects a user's Tally application with their mobile phones and gives them regular insights to drive action in the organization.What will a Product Engineering Intern do?A Product Engineer will take full charge of the product's UI & UX. TallyAssist mobile app...
remote Remote full-time 4w ago
javascriptpythonjavanodejsawsazuredockerkubernetes +4
Show description
Headquarters: Guatemala ¡Se parte del principal partner de AWS en Latinoamérica y ayuda a las empresas más grandes e innovadoras a acelerar su viaje a la nube! ️Somos un grupo de profesionales talentosos y apasionados en tecnologías en la nube, enfocados en el cliente y con capacidad de afrontar cualquier desafío. ¡Queremos que seas parte de nuestro crecimiento! Buscamos un DevOps Cloud Specialist especializado en infraestructura para unirse a nuestro equipo de tecnología. ¿Cuáles son los princi...
remote Remote full-time 4w ago
azureterraform
Show description
Headquarters: City Of Manila, Philippines Senior DevOps EngineerRole DefinitionThe DevOps Engineer is responsible for establishing and maintaining the cloud infrastructure, deployment pipelines, monitoring systems, and operational excellence practices that support the FanFair platform throughout development and production phases.Core ResponsibilitiesInfrastructure as Code: Design and implement Azure infrastructure using ARM templates, Terraform, or BicepCI/CD Pipeline Management: Build and maint...
remote Remote full-time 4w ago
pythonawsgcpdockerkubernetesnginxapacheblockchain +3
Show description
Headquarters: Hong Kong, Hong Kong The BCW Technologies Infrastructure (BCWT-I) team are seeking a Senior (5+ years experience) Systems Administrator with very high technical and English communication proficiency. This senior Dev Ops engineer will be responsible for entire verticals of operations while also being responsible for coordinating with other members of the team to communicate, develop, and maintain large scale systems.The BCWT-I team is growing and therefore often operates with a high...
remote Remote full-time 4w ago
pythongitlinux
Show description
Headquarters: Herzliya, Tel Aviv District, IL Description: Today’s world is crime-riddled. Criminals are everywhere, invisible, virtual, and sophisticated. Traditional ways to prevent and investigate crime and terror are no longer enough… Technology is changing incredibly fast. The criminals know it, and they are taking advantage. We know it too. For nearly 30 years, the incredible minds at Cognyte around the world have worked closely together and put their expertise to work, to keep up with con...
remote Czechia full-time 4w ago
postgresqlkubernetesgit
Show description
A Little About Us EDB provides a data and AI platform that enables organizations to harness the full power of Postgres for transactional, analytical, and AI workloads across any cloud, anywhere. EDB empowers enterprises to control risk, manage costs and scale efficiently for a data and AI led world. Serving more than 1,500 customers globally and as the leading contributor to the vibrant and fast-growing PostgreSQL community, EDB supports major government organizations, financial services, media ...
USD 50-75/yr remote Worldwide freelance 4w ago
Show description
Our organization is seeking content writers to create articles and blog posts on a variety of topics. The rate of pay is $20 per 100 words (this comes out to approximately $100 per article or $50 per hour). Some topics you may be asked to write about include the following (you can always turn down a topic if you do not feel comfortable writing about it, however if you have experience or expertise in a specific area, please let us know): Health & beauty Fitness Home Decor Fashion Sports Do it you...
remote Remote full-time 4w ago
pythonllmmachine-learning
Show description
Headquarters: Remote - Global About TuringBased in Palo Alto, California, Turing is one of the world's fastest-growing AI companies accelerating the advancement and deployment of powerful AI systems. Turing helps customers in two ways: working with the world’s leading AI labs to advance frontier model capabilities in thinking, reasoning, coding, agentic behavior, multimodality, multilingualism, STEM and frontier knowledge; and leveraging that expertise to build real-world AI systems that solve m...
remote Remote full-time 4w ago
Show description
Headquarters: Argentina About UsSingular is the next-gen attribution and marketing analytics platform, giving marketers actionable insights from previously siloed data. By collecting, aggregating and normalizing upper-funnel campaign marketing data from thousands of channels and connecting it to lower-funnel attribution data, marketers can measure ROI from every touchpoint across all their activities and optimize to the most granular level. We have raised $50M from Norwest Venture Partners, Gene...
remote Remote full-time 4w ago
javaangularspringawsterraformkafka
Show description
Headquarters: Hyderabad Telangana India we are currently looking for a "FULL-STACK DEVELOPER As a Full Stack Developer for Finance Enabler you will be responsible for the development and integration of backend and frontend solutions. Details: Start: asap Workload: full-time Location: Remote (offshore) Your tasks will include: Development and maintenance of Java backend systems with asynchronous integration. Implementation of DevOps requirements using AWS infrastructure as code. Integration and m...
remote Remote full-time 4w ago
awsterraform
Show description
Headquarters: Montevideo, Montevideo, Uruguay About Trafilea Trafilea is a dynamic and innovative Tech E-commerce Group that operates multiple direct-to-consumer brands in the intimate apparel and beauty sectors, with a focus on using data-driven strategies to scale their businesses. In addition to our products, we have our own online community dedicated to promoting body positivity. As a rapidly growing global player, Trafilea is committed to creating high-quality products and services that enh...
remote Remote full-time 4w ago
kubernetesansibleprometheusgrafanalinuxbash
Show description
Headquarters: Yerevan, ER Welcome to Syrve, a leading provider of comprehensive software solutions for cash registers and restaurant management. With a strong foothold in the international market, we are proud to serve over 9000 customers worldwide and counting.Role DescriptionWe are seeking a skilled Linux Administrator to manage and maintain our Linux-based infrastructure. This role involves system administration, hardware configuration, virtualization, and performance monitoring to ensure hig...
remote Remote full-time 4w ago
Show description
Headquarters: Köln, Nordrhein-Westfalen, Germany, Köln, Nordrhein-Westfalen, Germany, Köln, Nordrhein-Westfalen, Germany, Köln, Nordrhein-Westfalen, Germany, Köln, Nordrhein-Westfalen, Germany, Köln, Nordrhein-Westfalen, Germany, Köln, Nordrhein-Westfalen, Germany, Köl Are you ready to be a technology leader in the SaaS space? Join epilot! We are looking for product minded engineers not only coders. We're seeking builders who bridge technical expertise with product strategy. If you're passionate...
remote Remote full-time 4w ago
pythonphpnodejsawsdocker
Show description
Headquarters: Paris, Île-de-France, FR Détail du posteLa sociétéNotre client est une société à taille humaine, qui développe notamment un réseau social (5 millions d'inscrits, 700 000 visites / jour).Leur mission est de proposer des produits qui permettent à nos utilisateurs d'être eux-même.En forte croissance, ils lancent de nouveaux défis dans les app et les communautés.Notre client pense que la liberté c'est ce qu'il y a de plus important, alors suite à la crise du covid ils ontdécidé de mett...
remote Remote full-time 4w ago
typescriptpythonrubyrailsawsgcpazurekubernetes +1
Show description
Headquarters: Paris, Île-de-France, FR Détail du posteLa sociétéLeur mission :rendre l'accès aux soins cardiaques de haut niveauaccessible à tous, n'importe où, n'importe quand.Pour concrétiser cette vision, ils tirent parti des technologies d'apprentissage automatique (IA) et de cloud computing. Leur premier produit est une application SaaS, déjà déployée dans le monde entier pour aider les médecins à diagnostiquer les maladies cardiaques.L'examen le plus courant pour diagnostiquer une arythmie...
remote Remote full-time 4w ago
pythonnodejsflaskpostgresqlawsgcpdockerkubernetes +9
Show description
Headquarters: Paris, Île-de-France, FR Détail du posteLa sociétéCréée en 2018 cette start-up a construit une plateforme basée sur du deep learningafin defournir des services de prédiction pour l'agriculture à grande échelle.Les clients utilisent leur smartphone pour diagnostiquer leur production en images. Une application simple qui permet de contrôler la pureté de leurs récoltes, les stocks de silos... Une tâche avant très onéreuse avec une fiabilité incertaine.La plate-forme s'appuie sur plusi...
remote Remote full-time 4w ago
pythonjavakubernetesterraformansiblekafkarabbitmqlinux
Show description
Headquarters: Bordeaux, Nouvelle-Aquitaine, FR Les missions du posteAmaris Consulting est une société indépendante de conseil et de technologies au service des entreprises. Avec plus de 1000 clients dans le monde, nous déployons des solutions pour les plus grands projets depuis plus d'une décennie - tout ceci est rendu possible par une équipe internationale de 7500 talents répartis sur les 5 continents et dans plus de 60 pays. Nos solutions sont axées sur quatre domaines d'activité différents : ...
remote Remote full-time 4w ago
awsgcpazurekubernetesterraformansiblejenkinscircleci +4
Show description
Headquarters: Toulouse, Occitanie, FR Les missions du posteJe suis consultante en recrutement au sein du cabinet RHéactive. Je vous accompagne dans la concrétisation de vos projets professionnels en vous proposant des opportunités sur mesure, en adéquation avec votre profil et vos attentes.Contexte de l'EntrepriseL'entreprise est une société innovante et passionnée par la technologie, spécialisée dans le conseil en systèmes et logiciels informatiques. Elle recherche un DEVOPS Senior pour rejoind...
remote Remote full-time 4w ago
pythonnodejspostgresqlmongodbelasticsearchdockerkubernetesansible +4
Show description
Headquarters: Toulouse, Occitanie, FR Les missions du posteAquisIT est une société spécialisée dans le recrutement de Talents IT, pour le compte de clients finaux au niveau national. Nous valorisons une approche humaine et des relations de confiances. AquisIT s'engage à être réactif et présent pour répondre à vos demandes. Nous avons également pour vocation de vous accompagner dans la recherche et dans la préparation de vos processus de recrutements avec nos clients.Nous recherchons pour le comp...
remote Remote full-time 4w ago
javascriptangularnodejsoracleawsgcpazuredocker +8
Show description
Headquarters: Les Clayes-Sous-Bois Descriptif du poste Dans le cadre de son développement Evidian recherche son Développeur DevOps Cloud (H/F) pour participer à la mise en place d'une infrastructure complète pour la solution IDaaS Evidian. L'objectif est de participer à la mise en place, support et R&Dde chaine d'alimentation Cloud. Votre rôle en tant que Développeur DevOps Cloud H/F -liste non exhaustive : - Automatisation du déploiement d'IDaaS pour de nouveaux clients ou pour des activités co...
remote Remote full-time 4w ago
pythonjavaangulardockerkubernetesgitlabiosgit +1
Show description
Headquarters: Montrouge, Île-de-France, FR Les missions du posteA propos de Crédit Agricole Corporate and Investment Bank (Crédit Agricole CIB) Crédit Agricole CIB est la banque de financement et d'investissement du groupe Crédit Agricole, 10ème groupe bancaire mondial en taille de bilan 2021 (The Banker, juillet 2022). Près de 8600 collaborateurs répartis dans plus de 30 implantations en Europe, Amériques, Asie-Pacifique, Moyen-Orient et Afrique du Nord, accompagnent les clients de la Banque da...
remote Remote full-time 4w ago
typescriptpythonmysqlmongodbkubernetesterraformansiblejenkins +6
Show description
Headquarters: Lyon, Auvergne-Rhône-Alpes, FR Les missions du postePourquoi choisir Stormshield ?- Vous voulez exercer un métier au coeur des actualités du moment, dans un marché porteur ;- Vous souhaitez intégrer un acteur européen, aux ambitions internationales ;- Vous êtes désireux d'apporter votre talent pour renforcer la confiance de nos clients et les cyber-séréniser ;- Vous êtes convaincu qu'un hacker n'est pas qu'un sombre personnage en capuche derrière son ordinateur ;- Vous souhaitez bé...
remote Remote full-time 4w ago
pythonawsgcpazurekubernetesterraformansiblejenkins +4
Show description
Headquarters: Rennes, Bretagne, FR Détail du posteConstruire une Infrastructure as Code sous Terraform ou Ansible ? Même pas peur !Y mettre du Kubernetes pour garder des containers up ? Un classique.L'héberger dans le Cloud ? AWS, GCP ou Azure, tu maîtrises.Automatiser le tout sous Gitlab ou Jenkins ? Les yeux fermés !Un petit coup de colle en Bash ou Python pour faire tenir le tout, ça passe large.Elastic Stack ou Prometheus pour monitorer ? Dilemme...Si de plus, tu es à l'aise avec les outils ...
remote Remote full-time 4w ago
pythonpostgresqlmysqlsqlserverawsgcpazuredocker +10
Show description
Headquarters: Kyiv city Ukraine Для нашого клієнта української IT аутсорс компанії, ми шукаємо DevOps Engineer в команду на довгострокову співпрацю. Проєкт пов`язаний із підтримкою інфраструктури, DevOps- завданнями та автоматизацією процесів у хмарних та локальних середовищах. Ви працюватимете з сучасним стеком технологій у сильній технічній команді, де є як джуніори, так і сеньйори. Очікування від кандидата: Мінімум 3 роки досвіду в адмініструванні Linux/UNIX та Windows. Впевнене розуміння веб...
remote Remote full-time 4w ago
pythonawsgcpazuredockerkubernetesterraformansible +8
Show description
Headquarters: About TruelogicAt Truelogic we are a leading provider of nearshore staff augmentation services headquartered in New York. For over two decades, we’ve been delivering top-tier technology solutions to companies of all sizes, from innovative startups to industry leaders, helping them achieve their digital transformation goals.Our team of 600+ highly skilled tech professionals, based in Latin America, drives digital disruption by partnering with U.S. companies on their most impactful p...
remote Remote full-time 4w ago
swiftreactweb3ethereumblockchain
Show description
Headquarters: United States About Us Chainlink Labs is the primary contributing developer of Chainlink, the decentralized computing platform powering the verifiable web. Chainlink is the industry-standard platform for providing access to real-world data, offchain computation, and secure cross-chain interoperability across any blockchain. Chainlink Labs helps power verifiable applications for banking, DeFi, global trade, and gaming by collaborating with some of the world’s largest financial insti...
remote Remote full-time 4w ago
typescriptrustclickhouserailwaygraphqlgit
Show description
Headquarters: United States This is a remote position available anywhere in the world! Linkedin makes us show a country, but we hire the best people wherever they are.Our core mission at Railway is to make software engineers higher leverage. We believe that people should be given powerful tools so that they can spend less time setting up to do, and more time doing.At Railway, we believe that making tooling more accessible for build and deployment is one of the greatest possible productivity unlo...
remote Remote full-time 4w ago
Show description
Headquarters: Los Angeles, California, USA Thanks for your interest in learning more about Jump! We are always on the lookout for talented product managers and product designers to join our growing team. So drop us a line if you're interested in being added to our talent pool. Read more about what we're building and how to stay in touch below.Jump is the only end-to-end fan experience platform built for sports teams and venues, breaking the mold for what fans can expect at live events. Jump’s en...
USD 14-5/yr remote USA part-time 4w ago
Show description
OVERVIEW Welo Data is looking for English speakers to join a remote project as a Search Quality Rater. In this role, you will help improve how search engines understand and deliver useful results to users. What you’ll do: Review search results and evaluate how helpful and relevant they are to the user’s query Answer simple true/false questions about the quality of content Rate whether search results meet the user’s needs using clear guidelines Complete straightforward online tasks that contribut...
USD 80-120/yr remote Worldwide contract 4w ago
figmastripe
Show description
We are hiring contract-based senior and director level product designers with experience leading complex product design projects. Original job posting link (URL here). About garden3d We are worker owned creative collective, innovating on everything from brands and IRL communities to IoT devices and cross platform apps. We share profit, open source everything, spin out new businesses, and invest in exciting ideas through financial and/or in-kind contributions. Our client roster includes Google , ...
remote Americas, Europe, Asia, Oceania full-time 4w ago
javascripttypescriptpythonrustgojavaphpreact +20
Show description
Are you a talented Senior Developer looking for a remote job that lets you show your skills and get decent compensation? Look no further than Lemon.io — the marketplace that connects you with hand-picked startups in the US and Europe. What we offer: The rate depends on your seniority level, skills and experience. We've already paid out over $11M to our engineers. No more hunting for clients or negotiating rates — let us handle the business side of things so you can focus on what you do best. We'...
remote Remote full-time 38w ago
swiftiosswiftuigit
Show description
Headquarters: Florida URL: http://www.speechify.com Overview With the growth of our iOS app, being the #18 productivity app in the App Store category and also our recent recognition as Apple's 2025 Design Award for inclusivity, we find the need for a Senior iOS Engineer to help us support the new user base as well as work on new and exciting projects to push our missing forward. This is a key role and ideal for someone who thinks strategically, enjoys fast-paced environments, passionate about ma...
USD 100-200/hr remote Remote full-time 98w ago
Show description
Headquarters: Brooklyn, NY URL: https://resources.storetasker.com/become-an-expert?apply=true&source=weworkremotely_best_2021 Shopify developers love to freelance with Storetasker. Endless, quality clients: from well known DTC brands to top agencies. Fully remote, flexible: work as much or as little as you want, wherever you want. A talented and helpful community: it's freelance (with a team). Earn $100-$200 per hour: pick your clients, and send your own quotes or retainers. We've connected our ...
remote full-time 312w ago
rustjavareact
Show description
Senior Software Engineers: Frontend, Full Stack & PlatformIf you are interested in working to advance human health with your software skills we'd love to talk with you. We are urgently searching for software engineering talent to help us help our customers understand and eradicate Covid-19.10x Genomics is hiring Senior Software Engineers with strong CS fundamentals and Java, Rust and/or React skills. Remote work available. The company HQ is in Pleasanton,CA.Please ping me to learn more christine...
onsite On-Site full-time 312w ago
ios
Show description
Zocdoc is hiring in NYC and PHX. We are looking to hire across all functions of tech, engineering, infra, and product. Please have a look below at our site and feel free to reach out! These roles are Full Time|On-SiteSenior Product Designer: https://www.zocdoc.com/about/careers-list/?job_id=Senior-Pro...Director of Product Management: https://www.zocdoc.com/about/careers-list/?job_id=Director-o...Product Operations Specialist: https://www.zocdoc.com/about/careers-list/?job_id=Product-Op...DBA: h...
full-time 312w ago
machine-learningios
Show description
Machine Learning Engineer - https://jobs.apple.com/en-us/details/200154882/ise-proactive...Have you ever scheduled a virtual meeting and received a suggestion to call into it at the right moment? Have you connected your Bluetooth headphones and received a suggestion to listen to your favorite podcast?We add intelligence across the iOS platform, build state-of-the-art privacy preserving on-device personalized models, and need your help! You will work on features that accelerate and delight millio...
remote REMOTE full-time 313w ago
javascalalinux
Show description
Telehealth - Ambra Health (https://ambrahealth.com) | REMOTE | Java / Scala / Linux Engineer, Medical Image Storage and Processing | Full timeAt Ambra Health we are doing something meaningful about COVID-19. We make it possible for doctors and patients to collaborate remotely, at locations around the world - including many renowned health centers. This involves managing a lot of medical data, getting it to the right place quickly and reliably over the Internet - some very challenging and interes...
remote full-time 313w ago
swiftoracleblockchain
Show description
Chainlink - https://chain.linkSmart contracts are on track to revolutionize how all agreements work, through an entirely new system of technologically enforced contract guarantees. We are well recognized for providing highly secure and reliable blockchain connectivity to the world's largest enterprises such as Google, Oracle, SWIFT, and many more. This is a unique opportunity to join one of the top companies developing cutting-edge blockchain technology while working closely together with a team...
onsite Software Engineer, Robotics full-time 313w ago
Show description
Neuralink | Software Engineer, Robotics | Full Time | Onsite | San Francisco, CANeuralink is developing ultra-high bandwidth brain-machine interfaces to connect humans and computers.Software Engineer, Robotics - https://jobs.lever.co/neuralink/c9061302-2cd8-47ef-a29f-b8e8...
onsite Software Engineer full-time 313w ago
python
Show description
DiaMonTech AG | Software Engineer | Berlin, Germany | Full-time | ONSITE / PARTIAL REMOTEWe are an innovative, venture-capital backed team with the goal to revolutionize the healthcare market for Diabetes.We have developed a new method to detect molecules in liquids and soft matter based on photothermal spectroscopy. Our first application is a non-invasive blood sugar monitor, that means we can detect blood sugar levels without finger pricking, pain, and blood. Our founders are a world-wide reno...
onsite Redwood City, CA full-time 313w ago
iosandroid
Show description
Skydio | Redwood City, CA | Full-Time | Wireless Systems Architect | Mobile (Android, iOS, Cross - Platform) | Platform (Cloud / Web / Embedded) | ONSITE (wfh during quarantine)To Apply: Send your resume to hiring@skydio.com (instantly reviewed by Hiring Manager)Skydio’s newest product was released in October 2019 and have received tremendous positive reception from consumer, enterprise and government markets. As we shift our focus in building specialized and high quality software and hardware, ...
onsite Data Engineer full-time 313w ago
pythonpostgresqlkubernetestensorflowmachine-learningkeraspandasnumpy
Show description
IOMED | Data Engineer | Barcelona, Spain | Full Time | OnsiteAre you looking for a job with a direct impact on healthcare?
* Problem: Clinical data is messy and makes research slow. * Mission: To structure clinical data and give unified, standardized access to it. * Product: Natural language processing models and a unified SQL data access interface for researchers. * Traction: Validated idea, Validated business model, growing and scaling stage. * Funding: +2y runout and growing. Backed by nation...
remote Senior Backend Engineer (Rails) full-time 313w ago
rubyrailsawsdocker
Show description
AMEX | Senior Backend Engineer (Rails) | Full-time | 6-12 Month Contract | REMOTE due to COVID-19 - Normally ONSITE | No Visa Sponsorship | Tokyo, JapanGlobal Dining Platform Solutions is looking for a Senior Backend Engineer to join our team and contribute towards our core global dining products. We are looking for a well-rounded individual who has experience with application and infrastructure development.We are looking for someone with the following experience:- At least 3 years of production...
onsite Software, Computer Vision, Machine Learning, UI full-time 313w ago
pythonmachine-learning
Show description
National Robotics Engineering Center | Software, Computer Vision, Machine Learning, UI | Pittsburgh, PA, USA | ONSITE | Full Time | H1-B VISAhttps://www.nrec.ri.cmu.edu/careers/index.htmlThe National Robotics Engineering Center (NREC), a robotics research and development powerhouse, is looking for experienced developers, especially in embedded systems, robotics, perception, deep learning, data science, and AI. For more than 21 years NREC has brought together a critical mass of software and hardw...
onsite Engineers, Eng Managers full-time 313w ago
blockchain
Show description
Ripple | Engineers, Eng Managers | Full-Time | ONSITE (Flexible WFH) | San Francisco, NYC, LondonRipple is the world’s only enterprise blockchain solution for global payments. Today the world sends more than $155 trillion across borders, however, the underlying infrastructure is dated and flawed. Ripple solves this problem. We connect banks, payment providers, corporations, and digital asset exchanges via RippleNet to provide one frictionless experience to send money globally. Ripple’s distribut...
onsite Office Manager + People Ops Lead full-time 313w ago
Show description
Curai Health | Office Manager + People Ops Lead | Full-time | Onsite | Palo AltoWe're hiring for a new workplace experience manager role at Curai in Palo Alto (although currently all working remote). We expand health care access and provide telemedicine services - we're pretty busy right now. It's a fun and diverse team with a culture of empathy and work-life balance:https://curai.com/work/workplace-manager
onsite Software Engineers full-time 313w ago
Show description
Skool | Software Engineers | Los Angeles (LA) | Full Time | Onsite | https://www.skool.comSkool builds simple and powerful collaborative tools for self-education. We're a small, self-organizing team of engineers and designers who want to make really great things. Craftsmanship, thoughtfulness, attention to detail and work ethic are important values to us. If you embody these values, you'll love working here.Senior Backend Engineer — https://jobs.lever.co/skool/8138378a-62c6-4b1c-a6c0-594126b8......
remote Engineering full-time 313w ago
Show description
Palmetto | Engineering| Full Time | RemotePalmetto is a clean technology company with a soul. Fundamental to our mission is “Leading the world to a clean energy future.” Our #1 Value is Customer Experience and we pride ourselves on over delivering. To learn more about our services visit Palmetto.com.Full Stack Engineer- https://jobs.lever.co/bandwidth/edd45330-0d47-4c91-b47b-54d4...
remote Engineering, Network Architect, Product full-time 313w ago
Show description
iStreamPlanet | Engineering, Network Architect, Product| Full Time | Remote |iStreamPlanet is one of the largest streaming platforms in the world for broadcasters; doing thousands of live events a each year. We are a unique organization with the size and feel of a small company, but the stability and world-reaching impact of a much larger enterprise.Sr. Site Reliability Engineer- https://istreamplanet.com/careers/?gh_jid=4004681003Site Reliability Engineer- https://istreamplanet.com/careers/?gh_...
onsite full-time 313w ago
pythonreactdjangogcp
Show description
Kolonial.no / Senior Software Engineers / Fulltime / On-site / Oslo, NorwayKolonial.no a Norwegian scale-up that has been building tech and logistics since 2013 - to challenge the ways we do grocery shopping.Building everything from end-user product experiences to logistics and distribution.We are hiring for software engineers who will be a part of our visionary Product & Tech team organised in cross-functional product teams with software engineers, designers, product managers and data scientist...
onsite Several Engineers full-time 313w ago
Show description
keylight | Several Engineers | Full-Time | On-site | Berlin Germanykeylight is a software provider and technology implementation expert within the Subscription Economy.We help our clients to build long-lasting customer relationships with their subscribers through our flagship software, Subscription Suite.We love making subscription commerce work!We are looking for highly motivated people with unique talents who want to achieve great things with us!• Senior Frontend Engineer - https://angel.co/l/...
onsite Bellevue, WA full-time 313w ago
aws
Show description
Sr Web Developer, Engineers, Internships | Bellevue, WA | Full-time | Onsite or Remote (US) | https://www.symetra.com/I am the hiring manager for this new product that we are building to disrupt the insurance industry. This is greenfield opportunity where we are building this as a startup (well-funded) where you get to innovate on the business, user experience as well as on the technology front.On the engineering side of the house, I have open positions for UX/UI designer, web developers, full s...
onsite Associate Product Manager full-time 313w ago
machine-learning
Show description
MU ENERGY | Associate Product Manager | Austin, TX | ONSITEWe are a small independent (self-funded & profitable) boutique SaaS company. Our end goal is to enable the green transition by providing the best Analytical Platform to the energy market participants. We do that by mixing together large amounts of Data with Math/Modeling/ML and awesome Visualizations. We are just getting started and have A LOT to build.We are looking for an high energy Associate Product Manager, ready to 1) obsess about ...
onsite Various full-time 313w ago
Show description
Evernote | Various | Full-Time| Onsite (Flexible WFH) | US & Chilehttps://evernote.com/careersClick on my profiler for contact info, if you have more questions.
remote full-time 313w ago
Show description
We’re hiring at Tellus App, Inc. Currently, we’re prioritizing those who are looking for non-remote jobs (people who can relocate or already in the Bay Area), but we are also open to hiring fully-remote. We’re growing quickly and aren’t looking to slow down the hiring pace.
We’re an ambitious Silicon Valley FinTech startup founded by serial entrepreneurs in 2016 to become the most innovative real estate investing platform for all. This unique sector is riddled with extreme fragmentation and plag...
Full-time full-time 313w ago
Show description
Front End Developer | Full-time | Bucharest, RomaniaSenior Digital Developer/ FullStack Developer - Fintech Apps | Full-time | Bucharest, RomaniaSales Director, Insurance | Full-time | Bucharest, RomaniaCustomer Success Manager | Full-time | Bucharest, RomaniaMore about the company - FintechOS - https://www.fintechos.com
Open jobs - https://fintechos.recruitee.com
onsite Full Stack Engineers full-time 313w ago
clojure
Show description
Oscaro | Full Stack Engineers | ONSITE in Paris (France) but partial remote ok | INTERNS welcome | Full-Time
Oscaro is the leader online auto parts selling website. We’re present in France, Spain, Belgium, Portugal, with our main offices located in Paris. We have ~80 engineers working in different, autonomous teams: ops, core services, front website, catalogue, data analysis, pricing, supply chain, etc. We mostly use Clojure, + various technologies depending on the team.Interview process: one fi...
Multiple Openings full-time 313w ago
php
Show description
Open Robotics - ROS/Gazebo| Multiple Openings | Singapore | Full-time | https://www.openrobotics.org/careersOpen Robotics, the team behind ROS, Gazebo and so much more is hiring for Software Engineers, Dev Ops, Web, Robot Engineers...Help us develop amazing open source tools and libraries to connect robots in healthcare environments. Helping robots, help people.Sr Software Engineer - https://openrobotics.bamboohr.com/jobs/view.php?id=60Software Engineer, Robotics - https://openrobotics.bamboohr....
remote full-time 313w ago
pythonreactnextjsredispandaskafkagraphql
Show description
My team at EverQuote (Cambridge, MA) is building a new business in the insurance space. If you like to tackle large market, care a lot about end user experience and want to build software that will forever transform the industry, please email me at klee+careers@everquote.com
I welcome remote engineers and am looking for experienced senior engineers who care about quality of their work, great organization and documentation and have worked in distributed teams in reactjs/nextjs/python/redis/kafka/...
onsite Various Positions full-time 314w ago
react
Show description
Windscribe | Various Positions | Full-Time | ONSITE (WFH available) | TorontoWe're a privacy company that builds consumer facing tools like VPNs, ad-blockers, and managed DNS (part of a standalone product).• Senior Systems and Network Engineer
• Intermediate React Frontend Engineer
• C++/Qt DeveloperTo apply, see https://angel.co/company/windscribe
remote Engineers, Data Scientist, Data Analyst full-time 314w ago
aws
Show description
SemanticBits | Engineers, Data Scientist, Data Analyst| Full-Time | REMOTE, VISA | https://semanticbits.com/SemanticBits specializes in the design and development of digital health services. We develop cutting-edge solutions for commercial, academic, and government organizations. We are headquartered in the DC area with offices in Virginia and India.The majority of the engineering and products team are completely remote, spread across more than 40 states. I started last year and am really impres...
remote Remote only full-time 314w ago
gitlab
Show description
GitLab | Remote only | Full timeAs the world’s largest all-remote company, GitLab is a place where you can contribute from almost anywhere. You’ll be part of an ambitious, productive team that embraces a set of shared values in everything we do.We’re hiring throughout GitLab, including support engineers, engineering managers, security engineers, sales development representatives, technical writers, product managers, technical account managers, solutions architects, sales managers, and strategic ...
onsite Software Engineers full-time 314w ago
javascriptpythonjavareactios
Show description
FanDuel | Software Engineers | Edinburgh (UK), Glasgow (UK), New York (US) | ONSITE https://fanduel.com/careers https://grnh.se/6f664f3b1Hiring for Java, Python, JavaScript/React, iOS Engineers.FanDuel Group has a presence across 45 US states and 8 million customers. Users love our products and the growth of our company means a constant need for great people.We've got two flagship products in the US market:1. The original FanDuel product, our Daily Fantasy Sports app created a brand new industry...
remote Full Time full-time 314w ago
Show description
Ad Hoc | Full Time | Remote | At Ad Hoc we build government digital services that are fast, efficient, and usable by everyone.|Senior Software Engineer - FHIR Developer Evangelist (remote)- https://boards.greenhouse.io/adhocteam/jobs/4480153002
- Senior Software Engineer ACO (remote) - https://boards.greenhouse.io/adhocteam/jobs/4655244002Ad Hoc brings small teams of highly skilled professionals from the private sector to build government software right the first time.Send questions to recruitin...
onsite iOS and Android Developers, 3D Environmental Artist, Tech Recruiter full-time 314w ago
iosandroid
Show description
Zenily (part of Snapchat) | iOS and Android Developers, 3D Environmental Artist, Tech Recruiter
| Paris, France |ONSITE (remote while the quarantine lasts) | https://zen.ly/jobsZenly began because we wanted an easy way to know what our friends were doing. Naturally, we created an app - a map that lets you see your friends and what they’re up to. Millions of people around the world have since made us realize that Zenly goes beyond letting you know what your friends are doing. It actually brings y...
onsite full-time 314w ago
rubyreactrailsreact-native
Show description
Fintory / Various Engineers / Full-Time / Onsite or Remote (flexible WFH) / Duisburg / GermanyWe are a young Germany based start-up that wants to change the way people interact with finance. In simple terms: we concept, design and develop digital products for the finance industry.---We are currently looking for:• Front-End Developer with React• and Back-End Developer with Ruby on Rails experience• as well as React Native Developerto contribute to the development team.If we piqued your curiosity,...
onsite Software Engineers full-time 314w ago
rubyrails
Show description
Scribd | Software Engineers | Amsterdam | ONSITEScribd is a reading subscription that gives you access to the best books, audiobooks, magazines, and more. Our mission is to change how the world reads. Beginning of this year we hit 1M paying subscribers (https://techcrunch.com/2019/01/28/scribd-1-million-subscribe...)! We are one of the oldest YC startups (YC '06), operating one of the largest Ruby on Rails sites.In Amsterdam we are hiring backend software engineers with solid experience in build...
remote Europe, REMOTE full-time 314w ago
haskellpostgresqlaws
Show description
Holmusk | Europe, REMOTE | Haskell Backend | Full-time | send your cv to [careers@holmusk.com](mailto:careers@holmusk.com)We ([https://holmusk.com/](https://holmusk.com/)) leverage technology & data science to accelerate research and improve outcomes in behavioural health & chronic diseases. We focus on delivering tailored interventions in healthcare by building digital tools and harnessing the insights from real-world data.We are looking for a Haskell Developer who is excited about making an im...
remote Developer Advocate full-time 314w ago
blockchain
Show description
æternity blockchain | Developer Advocate | UI/UX Designer | CMO | Project Manager | Director Asia-Pacific | REMOTE | https://angel.co/company/aeternity-blockchain/jobs
remote Front-end developer (Bootstrap, Jquery) full-time 314w ago
jquerydjango
Show description
Geeky Medics | Front-end developer (Bootstrap, Jquery)| Newcastle, UK | Part-time | Remote | https://geekyquiz.comGeeky Medics is a free online education platform for medical students. I founded it almost 10 years ago and have bootstrapped it to become one of the most popular educational resources for medical students. We more recently built out a collaborative quiz platform for the community and now have over 60k users. We have a skilled, remote, UK based Django developer on the team, who has b...
onsite NY (USA), Lausanne (Switzerland), Paris (France) full-time 314w ago
Show description
Inpher (https://www.inpher.io/) | New York (USA), Lausanne (Switzerland), Paris (France) | Software Engineers | Full-time | OnsiteAt Inpher, we believe that privacy and security are foundational to the future of computing and have built enterprise products to make this vision a reality.
We are a small team of veteran founders, world-renowned cryptographers and proven software engineers.
We are headquartered in New York City, with satellite offices in San Francisco and Lausanne, Switzerland, and ...
onsite Engineers and Designers full-time 314w ago
Show description
Routific | Engineers and Designers | Vancouver, BC | Full-time | Onsite & Visa | https://routific.comAt Routific we’re helping hundreds of businesses around the globe save time and fuel with route optimization. Our mission? To make route optimization accessible to every last-mile delivery company. Named one of Fast Company’s “World Changing Ideas”, we are creating a more sustainable world by reducing waste and greenhouse gas emissions.Headquartered in beautiful Vancouver BC, with sweeping views ...
onsite Software Engineers & SRE full-time 314w ago
android
Show description
Poloniex | Software Engineers & SRE | Full-Time | ONSITE (Flexible WFH, All WFH Temporarily) | Boston, MAPoloniex started as one of the first exchanges for trading cryptocurrencies and digital assets. Poloniex has attracted millions of customers and facilitated tens of billions of dollars of trades. We are dedicated to creating the most advanced digital asset exchange in the world. Join us and help build the future of finance!Senior Software Engineer, Android: https://poloniex.careers/?url=job&g...
onsite Power Electronics Engineer full-time 314w ago
Show description
Apollo Fusion | Power Electronics Engineer | Full-Time | ONSITE (partial WFH) | SF Bay Area, CA |
Apollo Fusion (https://www.apollofusion.com) makes electric propulsion systems for the big satellite constellations which will deliver internet around the globe. Currently we have an onsite opening for a Power Electronics Engineer in the bay area. See more at https://apollofusion.com/careers.html and apply here: jobs@apollofusion.com
onsite Engineering, DevOps, QA full-time 314w ago
Show description
Azlo|Engineering, DevOps, QA|Full-time|ONSITE in Portland, ORAzlo is a new, quickly growing fintech company that helps business owners, entrepreneurs, and freelancers pay, get paid, and manage their money. Backed by BBVA, we’re seeking to transform small business banking. In short, we’re here to help small businesses survive and thrive.We are aggressively growing our Engineering team - check out our open positions here: https://www.azlo.com/careers/
Full-Time full-time 314w ago
javascriptpythonjavaember
Show description
Addepar | Full-Time | Engineering | CA,NY,SLCAddepar is a wealth management platform that provides investors and advisors with a clear picture of their complex portfolios by aggregating and analyzing large amounts of financial data in real-time.As an engineer at Addepar, you will have the opportunity to make a big impact while solving complex problems and having a lot of ownership to do so! We have flexible hours/WFH policy, great benefits, and provide clear paths for career development.Our tech...
onsite www.ebay.com full-time 314w ago
machine-learningspark
Show description
eBay | www.ebay.com | New York | NYC | Full Time | ONSITE | wsalle@ebay.com | VISA okLooking for an applied researcher with true grit. Comfortable in the most challenging codebases and the most elegant systems alike. We need your help to reinvent the recommender systems experience. Work to improve our recommendations on the eBay item pages. https://www.ebay.com/itm/391756623227. We apply cutting edge machine learning techniques on petabytes of data and thousands of Spark/YARN nodes. This include...
onsite Software Engineer (+ More) full-time 314w ago
pythonjuliapostgresqlawsdockermachine-learninggit
Show description
Invenia | Software Engineer (+ More) | Full-Time | ONSITE | Winnipeg, Canada or Cambridge, UKWe are a team of scientists and engineers working together to solve key challenges that the world is facing, such as optimizing the world's electrical grids. We focus on using machine learning to optimize complex decision making and reduce inefficiencies.Being a part of the Invenia team presents an opportunity to work with and learn from amazing people with expertise in machine learning, theoretical phys...
remote Software Engineer (Contract) full-time 314w ago
gcp
Show description
pre-launch price tracker startup | Software Engineer (Contract) | Part-Time | Remote (US and EU preferred)We are looking for a contract Software Engineer for full-stack web app development in the cloud. We need an engineer with 2+ years of software engineering experience (code, system design, and cloud architecture). We prefer an engineer with Firebase and Google Cloud Platform experience, but if you’re curious, willing to learn, and able to solve problems, reach out. Please email me (address is...
Paris, FR full-time 314w ago
Show description
Streamroot | Paris, FR | Full-Time | Technical Product Manager, Lead Dashboard Developer, SRE EngineerStreamroot is hiring again! We're looking for engineers to join our team in Paris, to build the next generation or our client-side content delivery products.More about Streamroot: providing innovative OTT delivery solutions for media groups, internet companies and global businesses, Streamroot mesh delivery, e-CDN and multi-CDN orchestration technologies customize content delivery to each viewer...
remote Full Stack Engineer full-time 314w ago
javascriptjavaspringapache
Show description
Known2U | Full Stack Engineer | Full-Time | Remote | USA OnlySmall bootstrapped company in the ETL integration space. Looking for a full stack developer to help us build out our platform. Our core technologies are built around the java ecosystem(e.g. spring boot, apache camel). Ideal candidate would have experience working with java and associated technologies as well as a familiarity with sql and javascript. Depending on your comfort/desire besides working on the core of the product there are o...
remote IT/Engineering full-time 314w ago
aws
Show description
Cox Automotive | IT/Engineering | Full-time | Various Locations across US, CA, GA, NY, Remote Possible | Cox Auto makes buying, selling, owning and using cars easier for everyone. With our technology, market intelligence, and products and services, Cox Automotive simplifies the trusted exchange and mobility of vehicles and maximizes value for dealers, manufacturers and car shoppers. | AWS heavy | https://jobs.coxenterprises.com/job-search-results/?business...I have heard(from leadership) that hi...
San Francisco, CA & Dublin, Ierland full-time 314w ago
Show description
Intercom | San Francisco, CA & Dublin, Ierland | Full Time | https://www.intercom.com/careersIntercom is modern business messaging at scale. Build better customer relationships with scalable messaging that provides a more personal experience for you and your customers.SAN FRANCISCO:Product Engineer: https://boards.greenhouse.io/intercom/jobs/586072
https://boards.greenhouse.io/intercom/jobs/1962226Senior Product Engineer: https://boards.greenhouse.io/intercom/jobs/1031633
https://boards.greenhou...
San Francisco, CA full-time 314w ago
pythonjavarubyangularphoenixmysqlawstensorflow +5
Show description
One Medical | San Francisco, CA | Full-time | https://www.onemedical.com/careers/ One Medical is the fastest-growing primary care system in the country with over 80 locations in major cities nationwide. You’ll find our clinics in Boston, Chicago, Los Angeles, New York, Phoenix, Seattle, the San Francisco Bay Area, Washington, DC, San Diego, Portland and most recently, Austin.
Here are some of our core technologies, that largely depends on your department: Angular, Python, AWS, Spark, Ruby, MySQL...
onsite London, UK full-time 314w ago
javareactrailsspring
Show description
Lean Tech | London, UK | Full Time + Onsite | VISA | Senior Backend Engineer (Java + Spring) + Design Obsessed Frontend Engineer (React + Redux)Lean is on a mission to empower Fintech innovators. Our core product provides a single API for developers to access their user’s financial information stored within banks in the Middle East. Lean takes on the complexity of connecting to several banks, with several different data formats and various latencies to allow developers to make a single API call ...
remote Berlin, NYC, REMOTE full-time 314w ago
c#
Show description
Artsy | Berlin, NYC, REMOTE | Engineers + PM + Data AnalystArtsy is the leading marketplace for art. We're hiring across the board, see list of roles here: https://www.artsy.net/jobsTop priority are:
- Full Stack engineer
- Back End engineer
- Data engineerStrong preference for Berlin but REMOTE in the US or in our NYC office (once we get back there ;-) ) is available too.
remote Sr. Backend Engineer full-time 314w ago
python
Show description
Coefficient | Sr. Backend Engineer | Remote From India/North America | Remote Only | coefficient.ioWho we are
Coefficient is a VC-backed SaaS startup in the SF Bay Area. We are still in stealth and just raised a large seed round. The founders are serial entrepreneurs whose last startup, Shopular, was backed by Y Combinator and Sequoia and acquired by Rakuten Ebates.What we do
Coefficient is a self-service data warehouse for business teams. Today's data tools and BI stacks were designed for data ...
onsite Junior Analyst/Data Wrangler full-time 314w ago
pythonlinux
Show description
T1D Exchange | Junior Analyst/Data Wrangler | Full-Time | Onsite (WFH for now) | Boston, MAT1D Exchange is a nonprofit research organization dedicated to accelerating therapies and improving care for people living with type 1 diabetes.Follow the below link and it will show a Population Health Analyst role, but the group is also considering a junior analyst role that will focus on data cleaning and data wrangling to prep data for senior analysts. Use the same link to apply.Required Tech Skills: R...
onsite Utrecht, The Netherlands full-time 314w ago
javascripttypescriptpythonhaskellemberpostgresqlredisterraform +1
Show description
Channable - https://www.channable.com | Utrecht, The Netherlands | ONSITEJoin one of the fastest growing scale-ups in the Netherlands. We currently have several open engineering positions to join our team in Utrecht.
We are a young company with a strong engineering culture and some unique data problems, that we are solving for our customers. You can read more about the kind of work we do on our blog: https://tech.channable.com/Our Stack includes: Haskell, Python, JavaScript, TypeScript, Ember.js...
Python Engineer full-time 314w ago
pythonmachine-learning
Show description
causaLens |Python Engineer | Data Scientist (Commercial) | Data Scientist (Research) | Full-time | London |www.causalens.comWe are looking for a motivated and high-achieving Data Scientists, and Python Engineers based in London to join a team commercialising the next-generation machine learning technology.
This is a full-time placement with significant opportunities for personal development. We offer an intellectually stimulating environment, work within an interdisciplinary team and an inclusiv...
onsite Amsterdam full-time 314w ago
javapostgresqllinux
Show description
Adyen | Amsterdam | Onsite | Software Engineers (Java) & Infrastructure | Relocation and Visa supportedAdyen is a leading payments company. Speed is the foundation of our company. We think fast. We work fast. We launch fast. We're looking for software engineers that like to have ownership from inception to implementation, have a critical mindset, and care about quality and security.Back-end is written in Java, the platform is running on Linux and we are a big PostgreSQL user.Interested? Contact ...
remote Remote Global full-time 314w ago
react
Show description
Squad | Remote Global | Remote Only | ContractSquad is a rapidly growing video chat app. We’ve been working at the forefront of bring people together virtually for a long time and our mission is more important now than ever.We are looking for a strong react contractor who is passionate about pushing the limits of the web.https://squadapp.ioethan@squadapp.io
onsite Sr Full-stack Engineer, Sr Data Engineer, Data Scientist, Machine Learning Engineer, Sr iOS/Android Engineer full-time 314w ago
pythonrubyreactrailspostgresqlrediselasticsearchmachine-learning +2
Show description
Instacart | Sr Full-stack Engineer, Sr Data Engineer, Data Scientist, Machine Learning Engineer, Sr iOS/Android Engineer | onsite in San Francisco | https://instacart.comInstacart (YC S12) is building the best way for people everywhere in the world to shop for groceries. Using your phone or the web, you can order groceries and have them delivered to your door in minutes. You can choose from a variety of local stores, as well as being able to mix items from multiple stores into one order.Every da...
onsite Various engineering full-time 314w ago
javascriptstripe
Show description
Mux | Various engineering | Full-time | Onsite | San Francisco, CAAt Mux, we’re building the future of online video infrastructure.Think "Stripe for video" and a real-time analytics dashboard used by Fox while streaming the Super Bowl.You’ll be joining an amazing team from places like Google/YouTube, Twitch and Brightcove. Our founders previously started (and sold) Zencoder, an early leader in cloud video technology. We also authored Video.js, the biggest HTML5 video player on the web.We are loo...
onsite Many types of roles (inc Engineering) full-time 314w ago
javascriptaws
Show description
Atlassian | Many types of roles (inc Engineering) | Full-time/Contract/Intern/Grad/etc | Mix of onsite and remote [All remote for now] | GlobalRoles and number of open positions:Data & Analytics (16)
Design (25)
Engineering (106)
General & Admin (33)
Graduates (10)
Interns (15)
Marketing & Sales (61)Other (58)
Product Management (20)
Program Management (12)
Security (11)
Support (29)
Trello (3)Apply here: https://jobs.lever.co/atlassian?lever-via=SftTHN-4I0Atlassian engineers like to get their h...
onsite Full-time full-time 314w ago
Show description
Caption Health | Full-time | Onsite (currently all remote) | SF Bay Area | https://captionhealth.com/careers/You will become an integral member of a team that is working in AI for Healthcare. Specifically, Caption Health is empowering healthcare providers with new capabilities to acquire and interpret ultrasound exams using A.I. After recent FDA approval, we have begun working with several hospital systems and already have great testimonials during this hectic time. Apply via the link. I am the ...
onsite All Engineering Roles full-time 314w ago
javascripttypescriptjavareactawskubernetesreact-native
Show description
Lark Health | All Engineering Roles | SF Bay Area | Full-time | Onsite [All remote for now]I'm a VPE at Lark Health and we're growing!Healthcare, very important right now. Come and help us make the world healthier! :)We're actively hiring and have many positions:* Senior DevOps engineers expert in Kubernetes / AWS* Manager for the DevOps/Infrastructure team* Senior React Native Developer.* Different Engineering Managers Roles.* Backend Engineers role.Preferred stack is Javascript/Typescript, Jav...
remote full-time 314w ago
postgresqldockeransiblenginxgit
Show description
Coin Metrics (a leading provider of crypto asset data for institutions) Is looking a talented [Remote] Infrastructure Engineer. Key skills include PostgreSQL (admin, replication, backup…) Docker, Ansible, scripting, nginx, Git virtual and bare metal. See https://coinmetrics.io/careers/ for more details.
onsite Haskell Engineer full-time 314w ago
javascripttypescriptpythonhaskell
Show description
Interos, Inc. | Haskell Engineer | ONSITE Arlington, VA | Full-TimeMy team at Interos is hiring Haskell engineers. Feel free to contact me at jevans at interos.ai with any questions. NB. While this is ultimately an on-site position we are currently working fully remotely until the COVID-19 situation is resolved.Apply here: https://www.interos.ai/vacancies/#haskell-software-engineerWe are also hiring for Data Science, Python, DevOps, Product Management, Marketing, JavaScript/TypeScript, Designers...
remote Fullstack engineer full-time 314w ago
Show description
Amino | Fullstack engineer | Full-time | San Francisco (all remote for now)Amino is a healthcare financial wellness platform that helps companies & their employees navigate the complexities of the US healthcare system & find the highest value care, which has become even more important of late. We're seeing major growth in 2020 and are hiring junior/mid-level fullstack engineers to help us scale & improve our products.apply here: https://boards.greenhouse.io/aminohealth/jobs/1573195https://amino....
remote Various Roles full-time 314w ago
Show description
Protocol Labs | Various Roles | Remote | Full-time |Protocol Labs is a research, development, and deployment lab for network protocols. Protocol Labs creates software systems that tackle significant challenges, aiming to solve them with new technology breakthroughs, great user experience design, and an open-source approach to creation.•Engineering Manager IPFS https://jobs.lever.co/protocol/3f0787e8-58b3-4122-a1ea-42456...•Distributed Systems Technical Lead: https://jobs.lever.co/protocol/9283f9...
remote full-time 314w ago
javascriptelixirreactphoenixpostgresqlreact-nativegraphql
Show description
Papa is hiring 1 fullstack engineer to join our team. We're fully remote, great work-life balance and interesting problems to solve that DIRECTLY IMPACT PEOPLE. We're growing in great directions and building the future of the company TODAY.https://joinpapa.com/Our stack:Elixir, Phoenix, Javascript, React (web), React Native, Apollo, Graphql, Postgres, Aptible.Great engineering culture, CI/CD, auto-deploys, tests cover all new features and we're about 80% test backfilled for older features. This ...
remote full-time 314w ago
gitlab
Show description
GitLab is hiring. All positions are remote. https://about.gitlab.com/jobs/apply/ Customer Support, Development, G&A, Marketing, Product Management, etc.
onsite Engineer - Frontend/Full Stack/Backend/Infra full-time 314w ago
typescriptpythongoelixirawskubernetes
Show description
Brex | Engineer - Frontend/Full Stack/Backend/Infra | Onsite | Full-Time | SF, NYC, VancouverBrex is building the next generation of B2B financial services with better tech and without the restrictions of outdated legacy banking technology, starting with corporate cards for startups. We’re looking for engineers across all roles who want to be part of a team that believes that taking the time to make a thorough decision matters, where pride in our craft is a defining characteristic, and who are o...
GBP 45k-60k/yr remote full-time 314w ago
javascriptpythonrubyjqueryflaskrailspostgresqlaws +1
Show description
LearnerShape, AI-driven workforce skills startup
Ruby on Rails developer
Full-time (part time possible for right candidate)
£45-60K (depending on experience) plus equity Central London (remote in UK for right candidate)We are looking for a creative, ambitious Ruby on Rails web developer to help us address one of the key education problems posed by technological change: the need for workforces and individuals to retrain and learn new skills for new roles. We are an early-stage startup with substa...
remote DevOps Engineer full-time 314w ago
pythonpostgresqlredisdockerkubernetesansiblegitlinux
Show description
Thoughtexchange | DevOps Engineer | Canada | Full-time | RemoteThoughtexchange is world’s leading crowd sourcing platform that allows leaders to connect with every member of their team or community and crowdsource anonymized answers to open-ended questions.In this role, you will get to work across many different aspects of the stack: deployment, server side programming, security, cloud architecture, distributed Linux systems, performance and monitoring. We are responsible for running all of Thou...
USD 120k-180k/yr remote NY City/NYC and REMOTE USA full-time 314w ago
typescriptrubyvuenodejspostgresqlmongodbredismachine-learning +1
Show description
Alpha | New York City/NYC and REMOTE USA | Senior Fullstack Engineer, Engineering Lead | FULL-TIME | $120 - $180khttps://alphahq.com Alpha (alphahq.com) is a venture-backed growth-stage company based in New York, NY whose on-demand insights platform empowers clients to rapidly validate growth opportunities. Our clients use Alpha to accelerate experimentation, inform business decisions with customer wants and needs, deliver and scale agile research capabilities, and develop better products faster...
onsite Site Reliability Engineers, Robotics Software Engineers and Backend Engineers full-time 314w ago
Show description
Rapyuta Robotics | Site Reliability Engineers, Robotics Software Engineers and Backend Engineers | Tokyo, Bangalore | ONSITE | https://www.rapyuta-robotics.com/Rapyuta Robotics is a global technology startup that is pioneering the domain of cloud robotics. The ETH Zurich spin-off has about 50 employees, USD 24 million in funding, and has offices in Japan and India. rapyuta.io, the flagship product of Rapyuta Robotics, is an enterprise class cloud platform for robotics. By focusing on removing co...
remote Mid/Senior Dev & SRE roles full-time 314w ago
rustkubernetes
Show description
Ori Industries | Mid/Senior Dev & SRE roles | Global | Full-time | RemoteOri is looking for mid/senior level devs and SREs to work on cloud-native stuff. We build upon Kubernetes to provision Kubernetes clusters for Edge infrastructure.We do mostly Go at the moment and are looking at Rust for some critical parts.
The company is remote-first with a base office in London.Company info:https://www.ori.co/ , https://www.linkedin.com/company/ori-edge/, https://angel.co/company/ori-industries-1Job list...
remote Multiple Engineering and Design Positions full-time 314w ago
phppostgresqlrediselasticsearchdockerkubernetesrabbitmq
Show description
Sourceability | Multiple Engineering and Design Positions | Full-Time | Remote (US Remote or Berlin)Sourceability is an international Electronic Component Distributor currently building a Global E-Commerce Marketplace and related tools for our customers. Our e-commerce website can be found at https://sourcengine.com.Join a team of enthusiastic software engineers working on digitizing the Electronic Components industry through a Catalog system that is utilized by both internal and external consum...
remote REMOTE full-time 314w ago
pythonvuepostgresqlgcpdockerherokustripe
Show description
News Revenue Hub | REMOTE | part-time frontend developerWe help news organizations build financial sustainability— because we need quality journalism now more than ever. More here: https://fundjournalism.org/aboutWe're looking for a part-time frontend developer. Experience with Vue and SPAs is helpful. This role will also have the opportunity to work on backend/DevOps tech (Python, Docker, Postgres, Salesforce, Stripe, Heroku, GCP) if they're interested, but this is primarily frontend.Contact me...
onsite San Francisco, CA / Victoria, BC / Paris, France full-time 314w ago
javascriptrubyscalaelixirreactnodejsrailsredis +3
Show description
Change.org | San Francisco, CA / Victoria, BC / Paris, France | Onsite, VISA | https://www.change.orgChange.org is the world’s largest social change platform with over 280 million users in 196 countries. Change.org empowers anyone, anywhere, to create the change they want to see. We are a certified B-corporation and enable people to start campaigns, mobilize supporters, and work with decision makers to drive solutions through our platform.To learn more about who we are, our engineering culture, ...
remote Senior Fullstack Engineer (JavaScript/TypeScript) full-time 314w ago
javascripttypescript
Show description
Linear | Senior Fullstack Engineer (JavaScript/TypeScript) | Full-Time | Remote (US/EU timezone)Linear is building a streamlined for teams to manage bugs, tasks, projects and sprints.The company was founded in 2019, and today, hundreds of high-impact teams and companies are already using Linear daily to build next-generation software.We are a remote-first company, and backed by some of the best founders, angels and venture capitalists (Sequoia, Index Ventures) in the industry. Our founders are e...
USD 200-5k/yr onsite ENG roles full-time 314w ago
typescriptkotlinreactspringkubernetes
Show description
Hatch | ENG roles | SF, CA | FTE | Onsite/remote (although I guess we're all remote right now)Hatch is building financial and software products for SMBs--we're starting with short-term credit ($200-$5,000) at affordable, transparent rates for small businesses with no credit history or impaired credit history.Help us move millions of dollars around--our stack is Kotlin, Spring, React, and Typescript, k8s. We're hiring engineers across all parts of the stack who want to help small businesses in th...
onsite Lead Engineer and iOS Engineer full-time 314w ago
ios
Show description
Osmind | Lead Engineer and iOS Engineer| Bay Area | Full-time | Onsite [all remote for now]Osmind is building a care platform for FDA-approved psychedelic medicine. We build software to guide treatment-resistant mental health patients through the treatment journey, including a booking platform & community, patient-facing app, and provider tools.We're a team of two Stanford grad students (med school and business school) and are looking for our first engineering teammates focused on full stack web...
onsite Redwood City, CA full-time 314w ago
javascripttypescriptpythonjavaswiftiosandroidlinux
Show description
Skydio | Redwood City, California | Full-Time | Onsite (post-quarantine)Skydio is productizing state-of-the-art robot autonomy for consumer, enterprise, and government markets at unprecedented scale. Our founders met as MIT grad students and co-founded Google X's Project Wing. We have an exceptionally strong engineering teams spanning many disciplines, and seasoned product leadership from Apple and Tesla. We recently raised a $50M+ Series C to fund our upcoming growth phase.Skydio 2 Launch Video...
onsite All Roles full-time 314w ago
typescriptpythonangulardockerkubernetestensorflowmachine-learningkeras
Show description
Opsani | All Roles | California | Full-time | Onsite/Remote [All remote for now]Opsani is an ML-enabled continuous cloud optimization solution to improve performance and cost. It has raised a Series A from Redpoint Ventures and Costanoa.Opsani is building an innovative product using the Agile development framework and DevOps principles. We believe that both a high-quality team and a high-quality codebase are critical pieces of our mission. Our stack uses Angular and Typescript for the front-end,...
remote https://scrapinghub.com full-time 314w ago
pythonmachine-learning
Show description
Scrapinghub | https://scrapinghub.com | 100% Remote |Full-time | Multiple rolesWe develop a wide range products including:
AutoExtract - API for automated e-commerce and article extraction from web pages using Machine Learning.
Crawlera - smart crawling proxy
Scrapy Cloud - a cloud platform for running spiders
Data on Demand - turn-key web scraping services and more!Come join our fully remote team of over 180 people in 30 countries.You'll have the chance to work on projects that build and transf...
onsite Backend engineer, Full-Stack Engineer, Frontend Engineer, Principal Architect, Site Reliability Engineer Menlo Park, CA full-time 314w ago
typescriptscalareactrailspostgresqlansiblerabbitmqlinux
Show description
Strateos (YC W15) | Backend engineer, Full-Stack Engineer, Frontend Engineer, Principal Architect, Site Reliability Engineer Menlo Park, CA | https://strateos.com | ONSITEStrateos is creating a fully automated, integrated, and programmatically controlled science lab to change how science is performed. Scientists anywhere can define and (reproducibly!) run experiments over the internet on-demand and without investing up-front in a lab facility.
Tech stack includes: Linux, Scala, RabbitMQ, Rails, ...
onsite Palo Alto, CA full-time 314w ago
javaswiftkotlinobjectivecreactawsiosandroid
Show description
Wealthfront | Palo Alto, CA | Onsite | https://www.wealthfront.com | VISAWealthfront is a nextgen banking service. We help you manage your money for both the short term and long term by providing a high-interest cash account, best in class automated investment management, and free financial advice, all through our five star rated mobile app. We believe that everyone deserves access to sophisticated financial advice, without the hassle or high fees.To learn more about who we are, our engineering ...
onsite San Francisco, CA and Minsk, Belarus full-time 314w ago
rubyrailsmongodb
Show description
Sensor Tower | San Francisco, CA and Minsk, Belarus | Full-Time, Onsite | https://sensortower.com | VISASensor Tower provides key metrics for everyone involved in the mobile ecosystem. Whether you’re a mobile app developer, a financial institution performing mobile market research, or a large brand thinking about your mobile initiatives, we provide your one-stop shop for due diligence.Learn more about our engineering culture here: https://www.keyvalues.com/sensor-towerAnd check out our open role...
onsite Full-Stack Engineers full-time 314w ago
javascriptpythonjavarubymachine-learning
Show description
Sotheby's | Full-Stack Engineers |Full-time | NYC | Onsite/RemoteSotheby's (the first international auction house) is hiring senior full-stack engineers (plus many other data/cloud architect positions) for the data and machine learning teams. Looking for candidates who want to work closely with product managers, engineers, designers, and stakeholders across the company.5+ years of experience in full-stack web development building scalable and responsive web-based applications
Experience with one...
onsite Staff Software Engineer, Cloud Infrastructure full-time 314w ago
kubernetes
Show description
Airbnb | Staff Software Engineer, Cloud Infrastructure | Full-time | Onsite | San Francisco/San Jose, CaliforniaAirbnb is looking for experienced staff level software engineers to join our Cloud Infrastructure team. Cloud Infrastructure is a foundational team that manages the compute clusters, cloud deployments and service discovery infrastructure used to serve traffic to the millions of global Airbnb users. We work with approximately 1,500 product engineers within Airbnb and run many tier 0 ser...
onsite Full-time full-time 314w ago
javascriptnodejspostgresqlrediselasticsearchawsdockerrabbitmq
Show description
Hubdoc @ Xero | Full-time | Onsite | Toronto, Canada | https://www.hubdoc.comRegularly onsite, all remote for now...Senior Software Developer: https://app.jobvite.com/j?cj=oRmlcfwu&s=Hacker_NewsSoftware Developer: https://app.jobvite.com/j?cj=oERlcfwM&s=Hacker_NewsYou will become an integral member of our document workflow team, who are responsible for all customer facing aspects of the Hubdoc application. Your remit will be focused on our web, and mobile front-ends and their supporting APIs as ...
onsite Site Reliability Engineer full-time 314w ago
awsansible
Show description
Thinknum | Site Reliability Engineer | Full-Time | Onsite | Visa Sponsorship | New YorkThinknum creates datasets from a broad array of public online sources, capturing ephemeral information on the products, operating markets and labor markets of 400,000+ global companies across sectors, and provides rich toolsets for extracting intelligence. Last year, we closed a $11.6M round.Thinknum is looking for an experienced SRE to join the team in our NYC office.Requirements:* An obsession for building s...
onsite Software, Sr. Software, Sr Frontend full-time 314w ago
Show description
Applied Intuition | Software, Sr. Software, Sr Frontend | Bay Area, Detroit | Onsite, VISA | Full-timeHelp determine the future of autonomy. Applied Intuition provides software infrastructure to safely develop, test, and deploy autonomous vehicles at scale. We've raised from A16Z and General Catalyst.Applied Intuition equips engineering and product development teams with software that makes it faster, safer, and easier to bring autonomy to market. Headquartered in Silicon Valley with offices in ...
remote Offices in London, UK, Rennes, Fr full-time 314w ago
pythonswiftkotlinobjectivecreactpostgresqlkubernetesansible +2
Show description
New Vector (Matrix.org & Riot.im) | Offices in London, UK, Rennes, Fr | REMOTE | Full-time | Team of 40 growing rapidlyNew Vector is the startup which employs the core team behind Matrix (https://matrix.org) - the leading project for secure, open decentralised communication.
Matrix’s mission is to make messaging as open as email -allowing everyone to choose where their data is hosted, enjoy private conversations thanks to multi-device end-to-end encryption, and ultimately be in control of their ...
remote full-time 314w ago
javascriptpythonreactdjangopostgresqlmysqlmongodbredis +9
Show description
REMOTE (Worldwide) - Open Source Developer on Open edX - React, Python/Django, AWS/OpenStack (OpenCraft - Fully remote company)Development specialized on the free software project Open edX, used by and in part developed by organizations like MIT, Harvard, McKinsey, and others, so you’ll have the opportunity to contribute to projects that are widely used and to be part of a thriving open source educational community. See edx.org, stanford.edu or fun-mooc.fr for examples of Open edX instances.We a...
remote Senior Software Engineer full-time 314w ago
javascriptjavareactmysqlredisapachesparkkafka +2
Show description
HubSpot | Senior Software Engineer | Cambridge, MA REMOTE | Full timeHubSpot helps millions of organizations grow better, our business builds the software and systems that power the world’s small to medium-sized businesses.We’re looking for top engineering talent to join our small, customer-driven development teams to work on a variety of projects including:Back End: We write lots of micro-services, primarily with Java 11. Our APIs are RESTful and use the minimal Dropwizard framework. We take ad...
onsite Full-time full-time 314w ago
typescriptc#elixirreactphoenix
Show description
Carnegie Mellon University | Full-time | ONSITE | Pittsburgh, PAThe Simon-Initiative at CMU is building a learning engineering ecosystem that can scale and deliver effective online and hybrid courses worldwide.We are hiring for Software Engineer and UX Designer roles:Tech stack is React/Typescript and Elixir/Phoenix.Job links:https://cmu.taleo.net/careersection/2/jobdetail.ftl?job=2015...https://cmu.taleo.net/careersection/2/jobdetail.ftl?job=2015...
remote NY, NY (NYC) full-time 314w ago
typescriptreactsass
Show description
thelab | New York, NY (NYC) | Senior Frontend Developer | http://thelabnyc.com | Full-TimeWe are looking for an experienced front-end developer to work with our client’s e-commerce businesses. The ideal candidate would have experience working closely with designers and large frontend codebases. We are looking for someone who is self-motivated and is able to work with a team early on in a project, plan and identify requirements, see a project through to completion, and mentor junior members of th...
full-time 314w ago
Show description
ZeroTier is searching for someone on a one-time consulting basis (with possible ongoing support) to create a macOS Catalina (and future) DriverKit based Ethernet "tap" driver for use with our ZeroTier network virtualization product.https://www.zerotier.com/https://developer.apple.com/documentation/driverkitIt should provide an API that allows the easy creation and destruction of tap devices, preferably integrate nicely with the Mac network management stuff (so they show up as normal ports). Supp...
onsite All R&D Roles full-time 314w ago
rubyreactrailsreact-nativekafkagraphql
Show description
Shopify | All R&D Roles | Global | Full-time | Onsite/Remote [All remote for now]Shopify is hiring for all R&D roles!We’re an all-in-one commerce platform building tools to start, grow, market, and manage retail businesses of any size (from your fave local shops to behemoths like GymShark and Allbirds).We support over 1 million merchants on our global platform. Our current stack is primarily Ruby, Rails, React, React Native, Go, Kafka, GraphQl, etc.We’re looking for builders who want to solve hi...
onsite London full-time 314w ago
javascripttypescriptjavascalareactpostgresqlmongodbredis +12
Show description
Tray.io | London | Backend Engineer (Scala/Java) / Security Engineer / Frontend Engineer | Security Engineer| Site Reliability Engineer| Technical Support Administrator| Full-time | Onsite | https://tray.ioTray is a visual programming platform. It’s a low-code user experience that allows anyone to build business logic that precisely defines how data flows through their organisation.We’re a well-funded startup with a team in San Francisco and 100+ in our London Engineering HQ. We have secured a h...
Active learning AI for Pricing full-time 314w ago
machine-learning
Show description
Arena | Active learning AI for Pricing | NYC | Full-time | https://arena-ai.com/Hiring 1 Machine Learning Scientist & 1 Front-End engineer. Founded by YC alum (Kimono W14). Team = 5 ppl. Founded < 1 year ago. Profitable. Hyper-linear growth.Email us at careers@arena-ai.comToday, we are focused on pricing. We built a simulator that models hyper-specific market conditions and competitor dynamics to allow human users and AI agents to predict what will happen if they change the price of a product.Pr...
remote Backend Software Developer (Golang) full-time 314w ago
go
Show description
Linden Lab (Tilia) | Backend Software Developer (Golang) | Full-time | Remote in CA, CO, FL, GA, MA, NH, TX, VA, WATilia is an emerging FinTech company that makes it possible for game companies to pay content creators for their game content. We are a small team of hard workers solving hard problems. We value work-life balance, have great senses of humor, trust each other, and embrace the habit of continual improvement.We're looking for someone who shares those values and who is already productiv...
remote AI powered car search full-time 314w ago
javascriptreact
Show description
Driverbase | AI powered car search | Full-time | REMOTE-FIRST (United States) | https://driverbase.comWe are building a better car search experience that helps drivers find their optimal vehicle based on their unique situation and transact with top rated dealerships.We are hiring for:
1. Director of Engineering (AI)
2. Software Engineer
3. React JavaScript Developer
4. Community ManagerApply Here:
https://driverbase.com/company/careers/We have been remote first since we started in 2018. Our curr...
onsite Full-time full-time 314w ago
javascriptjavareactnodejsawsreact-nativeandroidgraphql
Show description
NewsUK | Full-time | Onsite | LONDON, UK | Newsuk bringing you the likes of The Times & Sunday Times, TheSun, talkSPORT, Virgin Radio, TimesRadio & talkRADIO.Tech Stack- JavaScript, React, ReactNative, Node.js, GraphQL, Go, Java, AWS.Currently hiring-Principal Engineer (Java) https://www.newscareers.co.uk/vacancies/452/principal-engine...Full Stack- https://www.newscareers.co.uk/vacancies/503/senior-full-stac...Android Engineer- https://www.newscareers.co.uk/vacancies/446/software-enginee...Soft...
remote Software Engineer in Test full-time 314w ago
Show description
Reify Health | Software Engineer in Test | Full-time, 100% Remote | https://www.reifyhealth.com/At Reify Health, we are building a more creative healthcare system. We envision a world where every potential therapy, if safe and effective, is available to the patients who can benefit. We are well-funded and backed by Tier-1 venture capital firms. Our healthcare system relies on clinical trials to develop new (potentially life-saving) treatments for patients, but clinical trials continue to be slow...
onsite Senior Software Engineer full-time 314w ago
typescriptreactpostgresqlgcpkubernetes
Show description
Eleanor Health | Senior Software Engineer | ONSITE (Greater Boston), REMOTE | Full-timeEleanor Health provides a revolutionary new approach to the complex disease of SUD and turns the tide of the opioid epidemic: bringing the first comprehensive, “whole person” care solution to the communities that need it most. Our goal is to help people heal, inside and out, for good. Through a combination of exceptional medical and psychological care, engaged community partnerships, and best in class technolo...
full-time 314w ago
Show description
Density (density.io) is actively looking for a contract to hire, on prem DevOps engineer. You can check out the job posting here: https://jobs.lever.co/density/b37a4c24-b043-4c14-a643-225280...
onsite Full-Stack Software Engineer full-time 314w ago
pythonreactpostgresqlaws
Show description
Headway | Full-Stack Software Engineer | NYC | Full-time Onsite | https://headway.coHeadway is a managed marketplace startup solving mental health’s affordability crisis. We get people access to affordable care by taking care of insurance on behalf of our network of therapists.We launched last April and are growing rapidly — already facilitating thousands of appointments for people who otherwise wouldn’t have been able to afford mental healthcare.To fuel our mission we're backed by the nation’s ...
onsite Full-time full-time 314w ago
typescriptpythonreactdjangojenkinsmachine-learningrestwebpack
Show description
Ventus Risk | Full-time | ONSITE/REMOTE | Raleigh,NC | W2 https://www.ventusrisk.com
Ventus Risk is looking for an experienced full-stack developer to join our team in NC. We are a group of experts in the property insurance space developing a new type of property underwriting system. The system is currently be used in production by a large amount of underwriters, and you will have the ability to make a large impact in performance and profitability.The current front-end stack is React+Redux, Type...
remote full-time 314w ago
Show description
Is it possible to add more specificity to the guidelines for REMOTE?
ie: US only, EU only, x-y timezones only, US/EU citizen, etcOtherwise there ends up being a lot of back and forth and wasted time over something that's solved in 2 seconds.
remote https://logicgate.com full-time 314w ago
typescriptjavaangularspringneo4jaws
Show description
LogicGate | https://logicgate.com | Chicago | Full-Time | REMOTE OKRiding a solid funding round from last fall and solid y/y ARR growth last year, we are growing into the current challenges.We provide an agile GRC process automation platform that combines powerful functionality with an intuitive design to enhance enterprise GRC programs.Here are just a few things we’ve been up to recently:- We secured $24.75M in Series B Financing in December 2019 to help us continue our mission
- We earned our ...
full-time 314w ago
Show description
Shopify is hiring for all R&D roles at https://www.shopify.com/careers
onsite Software Engineers full-time 314w ago
pythonjavareactkubernetesdatadog
Show description
Datadog | Software Engineers | ONSITE (Boston, NYC, Paris) and REMOTE | Full-timeDatadog is a monitoring, tracing, and logs system for your infrastructure and services. We build our own tsdb, distributed tracing tools, cutting edge visualizations, and more. We love shipping great experiences for customers just like us and are growing fast!We write Go, Python, Java, and React, (mostly) run on k8s, and are multi-region and multi-cloud.We're looking for people who can build systems at scale as we p...
full-time 314w ago
Show description
Zup Innovation - Brazilian Company Acquired by Itau Unibanco.
One of the biggest consulting companies in technology and digital transformation in Brazil territory.We are looking for all developers, PMs and jedis to join our team to build the next step in digital banking, telecommunications and tech foundation.For devs by devs.
https://www.zup.com.br/vagas
My Linkedin Profile - https://www.linkedin.com/in/souzawolf/
remote https://litmus.com full-time 314w ago
rubyvueemberrails
Show description
Litmus | https://litmus.com | Boston | Full-Time | REMOTELitmus is building a platform to help email marketers, agencies, and companies send better email. We write and maintain tools that cater to the email design process, like creating the HTML/CSS, collaborating with others on the design, verifying accuracy with email client screenshots, and analyzing campaign performance.We're hiring a Rails developer (we do have Vue and Ember in use, too). You'd work alongside a team of smart, curious, and s...
onsite ory.sh full-time 314w ago
goreactkubernetes
Show description
ory | ory.sh | Germany | Full-Time | On-Sitehttps://github.com/ory/jobs
We build stuff for an emerging cloud infrastructure.It’s security, zero trust, hardcore bullet proof engineering.It’s Golang, K8S, React, Hashicorp etc. - no more buzzwords!Just open an issue and go ahead, make our day :) - or drop us a short introductory email to jobs@ory.sh.We believe that great engineering deserves to be paid accordingly.Our open positions (all full-time in Munich, Germany):Software Engineer / Go https://...
full-time 314w ago
ios
Show description
Current is a leading U.S. challenger bank built to meet the needs of people with unique lives who have been overlooked by the traditional banking industry. We believe banking should be accessible and affordable for all Americans and are bringing premium financial services to everyone, regardless of age or income level, to help improve financial outcomes.We are hiring for:-iOS Engineer (https://boards.greenhouse.io/current81/jobs/1152093)-DevOps Engineer (https://boards.greenhouse.io/current81/jo...
onsite https://www.axon.com/ full-time 314w ago
Show description
Axon | https://www.axon.com/ | Frontend, Backend, Full-Stack | Seattle, WA and Scottsdale, AZ | Full-Time | ONSITEAxon is building a network of devices to help law enforcement become smarter and safer. Our mission is to protect life, as our technologies give law enforcement the confidence, focus and time they need to keep their communities safe. Check out this short video to see our vision: https://vimeo.com/372961760Axon Records is building a brand-new cloud-based web platform that cuts down on...
onsite Multiple Roles full-time 314w ago
javakubernetes
Show description
Celonis | Multiple Roles | Munich (Germany) & New York City | ONSITE | https://www.celonis.comBeing a global hyper-growth leader in process mining technology, our goal at Celonis is to establish our Intelligent Business Cloud (IBC) as a standard SaaS solution in any company.Our Intelligent Business Cloud harnesses the power of our Process Mining technology to help organizations remove operational friction and become a Superfluid Enterprise. Companies around the world, including Siemens, L’Oréal,...
remote Software Engineers & More full-time 314w ago
Show description
Paige | Software Engineers & More | NYC | Full time | REMOTEPaige is using AI to improve cancer diagnosis and treatment. We have raised $70M+. You'll be part of a team of experts in software engineering, AI, and cancer research.We have multiple roles open, including:- Sr. HL7 Engineers - https://grnh.se/9533cb162- Sr. AI Engineer - https://grnh.se/62b8746c2- Sr. Backend Engineer - https://grnh.se/676fa8ae2Additional software engineering positions, legal roles, and financial jobs are also open: h...
onsite Product Managers full-time 314w ago
Show description
CMS (US Gov) | Product Managers | Woodlawn, MD | Onsite | https://www.usajobs.gov/GetJob/ViewDetails/561960700The Centers for Medicare and Medicaid Services (CMS) in the federal government is hiring product managers (I believe its the first time that CMS has posted with this position title).It's in WOODLAWN, MARYLAND, but some of the multiple openings at CMS won't require in office work most days of the week. The role would work for people that are relatively junior (with at least one year of pr...
onsite ONSITE full-time 314w ago
machine-learning
Show description
Issuu | ONSITE | Copenhagen/Denmark or Berlin/GermanyWe're looking for several engineers to join our team, working on next generation story telling.- Full Stack Engineer https://jobs.lever.co/issuu/e80e3f6e-4e2a-4e63-b6df-61f16d4b...
- Sr. Frontend Engineer, https://jobs.lever.co/issuu/ed960e4e-97ee-4da6-a0b7-b779c161...
- Sr. Machine Learning Engineer, https://jobs.lever.co/issuu/e4f0db3c-6215-4050-b861-aae2e8cc...Other positions https://issuu.com/careersMust be qualified for a EU work permit.
onsite Full-stack, Research engineers/scientists full-time 314w ago
pythonjavareactvueangularspringawsdocker +2
Show description
Minimax Labs | Full-stack, Research engineers/scientists | London, UK | ONSITE/REMOTE, INTERNS, FULL-TIME, | http://minimaxlabs.comWe optimise complex, global operations for billion dollar businesses worldwide with a focus in the energy industry, creating massive value out of thin air and a little cloud.To support rapid growth, we’re looking for full time employees to work on several exciting new projects and development of our industry leading technology and product. We seek strong full-stack e...
USD 131k-192k/yr full-time 314w ago
Show description
I know public service roles are salary capped, but it's distressing to me that the CIO of the FBI will be making only "$131,239 to $192,180" which is less than even a medium-sized tech company executive would make. This person would be the front line of security defense for our top law enforcement agency and the enemies of that agency have billions of dollars of funding. It just seems like we should be paying for the talent we actually need at that level.
onsite Senior Product Managers, Senior Designers, Senior Software Engineers, Senior Site Reliability Engineers, and more! full-time 314w ago
Show description
United States Digital Service | Senior Product Managers, Senior Designers, Senior Software Engineers, Senior Site Reliability Engineers, and more! | Washington, DC | ONSITE https://www.usds.gov/We're looking for the most tenacious designers, software engineers, product managers, and more, who are committed to untangling, rewiring, and redesigning critical government services. You'll join a team of the most talented technologists from across the private sector and government. No government experi...
onsite full-time 314w ago
reactnodejspostgresqlgraphql
Show description
LatticeFull-time / Software Engineer / ONSITE : SF & NYLattice makes performance management software for forward-thinking organizations. We work to help make work meaningful.https://www.linkedin.com/company/lattice-hq/about/- react, node, graphQL, postgreshttps://lattice.com/job?gh_jid=4430753002
onsite ONSITE, Nationwide full-time 314w ago
Show description
FBI | ONSITE, Nationwide | Various* Chief Information Officer - https://apply.fbijobs.gov/psc/ps/EMPLOYEE/HRMS/c/HRS_HRAM_FL...* Computer Scientist - https://apply.fbijobs.gov/psc/ps/EMPLOYEE/HRMS/c/HRS_HRAM_FL...* Data Analysis - https://apply.fbijobs.gov/psc/ps/EMPLOYEE/HRMS/c/HRS_HRAM_FL...* Electronics Technician - https://apply.fbijobs.gov/psc/ps/EMPLOYEE/HRMS/c/HRS_HRAM_FL...* Special Agent - https://apply.fbijobs.gov/psc/ps/EMPLOYEE/HRMS/c/HRS_HRAM_FL...Must be a US Citizen. Must be able ...
onsite https://layertwo.info/ full-time 314w ago
rust
Show description
LayerTwo | https://layertwo.info/ | Junior and Senior Backend Engineers (Rust) | London, U.K. | Full Time | ONSITELayerTwo is the first Bitcoin derivatives trading engine that uses the Lightning Network to allow traders to instantly trade without exposing their funds to seizure, theft or long transfer times.We're big fans of Rust and have built everything from the ground up with it. We are looking for senior and junior backend engineers to join our team.For questions or to apply reach out to car...
remote Experienced Frontend Developer full-time 314w ago
rails
Show description
Hexagonal | Experienced Frontend Developer | France, Netherlands | Full-time | REMOTEHexagonal is a web agency built around Faveod, which is macro-programming on top of Rails.Our client are big French companies that are sick and tired of the old contracting way of doing things.We do everything from idea to execution and long-term maintenance. That is project definition, project management, design (real, with artists), frontend, backend, devops, and infrastructure.We wanted to make the company wh...
onsite Frontend, Backend full-time 314w ago
javascripttypescriptjavareactangularspringkubernetes
Show description
QAware | Frontend, Backend | München (Munich) / Mainz, Germany | Full-time, Part-time, INTERNS, ONSITEQAware is a project house with ~115 employees, creating value for enterprise customers like BMW, Deutsche Telekom, Allianz and more. QAware was founded in 2005 and is very well funded.We are continuously ranked among the top employers in Germany ([1], [2]) - in 2020 we are ranked 2nd in whole Germany. For more perks, see [3]. I'm already working there for 6 years, as my managers are treating me ...
remote Senior Frontend Developer full-time 314w ago
javascripttypescriptvue
Show description
Brankas | Senior Frontend Developer | Indonesia, Philippines, Thailand or Vietnam | Full-Time | REMOTEBrankas is solving the "last mile" for Open Banking in Southeast Asia.We are a global team of banking software experts backed by leading fintech venture capital firms in Asia and Silicon Valley. Our vision is to make modern financial services available to everyone, by increasing access and encouraging partnerships between financial institutions and fintech partners.Brankas is building the next g...
remote REMOTE, London full-time 314w ago
reactdjangohelm
Show description
PostHog | REMOTE, London | Full-stack engineerPostHog is developer-friendly, open-source product analytics. Graduated YC W20, we were the most popular b2b software HN launch since 2012 [0]. Our GitHub repo [1] has 1.7k stars and a growing and active community.You'll be the first engineering hire. All of your contributions will be open source. We're remote first and happy to hire anywhere in the world. Looking for strong full-stack engineers. We use Django + React. If you're a full-stack engineer...
remote London, Singapore and REMOTE global full-time 314w ago
machine-learning
Show description
Tuune | London, Singapore and REMOTE global | CTO, Engineering ManagerWe're going to help the world cope with the explosion in remote working caused by Covid19. No more lifeless, Windows XP-esque videoconferences — our product will use technology as it should be: enhancing the human experience.To achieve our mission, we need to build an enterprise-grade videoconferencing platform that is 10X better than other tools out there, and we need to do it fast.We started 3 weeks ago and have secured an i...
onsite Berlin full-time 314w ago
c#awskubernetesprometheus
Show description
PubNative | Berlin | Site Reliability Engineer | Full-Time Onsite | https://pubnative.netWe are PubNative, a mobile monetization platform that enables app publishers to
enhance their revenue strategy through flexible ad units. Our infrastructure
serves high volume of requests around the world, 24/7/365.We're looking for Site Reliability Engineer to work on* managing lifecycle of Kubernetes clusters (in AWS and Packet), observing
* everything through Prometheus, developing CI/CD pipelines and gen...
onsite Various Engineers, other roles full-time 314w ago
Show description
Poly AI | Various Engineers, other roles | Full-Time | Onsite (flexible WFH) | London UK
PolyAI aspires to lead the digital transformation of customer services through conversational AI technologies. We believe the best team will consist of people with diverse perspectives, ideas, and cultures, reflecting the multicultural and multilingual background of our customers.
Our careers website can be found here: https://www.polyai.com/careers/
Please email ash@poly-ai.com should you wish to apply/ ask...
onsite Onsite in London, UK (remote for now) full-time 314w ago
javascriptnodejs
Show description
Ably | Onsite in London, UK (remote for now) | Full-time | https://ably.ioWe provide APIs to simplify and overcome the complex aspects of the most demanding realtime engineering. This reduces the operational burden of engineering teams, allowing them to build and scale realtime apps faster and more efficiently.we’re laying the foundations for mass deployments of Autonomous Vehicles, IoT networks, and AI-powered experiences.
We have openings for:- Site Reliability Engineer (contract)- Lead Site R...
full-time 314w ago
Show description
I've previously applied at Alto and have yet to receive a response...
onsite Gurgaon, India full-time 314w ago
react
Show description
Synaptic | Gurgaon, India | Senior Frontend Engineer (React) | ONSITE | https://synaptic.com/Synaptic is an alternative data platform that helps financial firms and investors get actionable insights from vast amounts of data. Built by former hedge fund data scientists, Synaptic helps investors every day in making better decisions.We are looking for a Frontend Engineer with a solid understanding of React and related technologies. We work with complex UIs with a large number of components, complex...
onsite Warsaw, Poland full-time 314w ago
python
Show description
PLECTO | Warsaw, Poland | Python Team Leader | Full-time | ONSITE | https://www.plecto.com/careers/ |Plecto is looking for a Technical Team Leader for our development office in Warsaw. You should be an expert in Python and have a strong interest in becoming a technical manager. We are currently a team of 6 full-time developers and plan to grow the team in the following year.We are a Danish SaaS startup with locations in Aarhus, Warsaw and London. Both founders have a technical background and bel...
onsite System Engineer, DevOps full-time 314w ago
Show description
Hex Trust | System Engineer, DevOps | Hong Kong | Full-Time, Onsite in normal times with home office, Visa sponsorship available | https://www.hextrust.com* https://hextrust.com/career/job/were-hiring-junior-system-engineer/
remote Remote (USA) full-time 314w ago
segment
Show description
Interview Schedule | Remote (USA) | Full Time | https://interviewschedule.com/careers/Want to join a lean, ambitious, and fast growing startup?
Interview Schedule is changing how teams hire. Our first product streamlines recruiting scheduling and coordination, saving teams hundreds of hours a month. We support fast-growing companies like Gusto, Segment, and Twitch. We have our sights set on making hiring a great experience for recruiters, hiring managers, and candidates. We’re building the platf...
remote REMOTE/ONSITE full-time 314w ago
Show description
ProPrivacy | REMOTE/ONSITE | Technical Writer/Journalist | https://proprivacy.comProPrivacy is helping teach people how to stay private and safe online, and we make revenue from commissions on products people buy through us.We are looking for writers and journalists who have fairly deep technical knowledge, about privacy, encryption, online tools etc. If you have a slightly rebellious, anarchist, libertarian attitude that helps a lot. We are about helping the small person against large governmen...
onsite Full Time full-time 314w ago
typescriptpythonjavakotlinscalareactnextjsaws +2
Show description
joyn.de | Full Time | ONSITE/REMOTE (London, UK and Munich, GER)We're building a streaming & Live-TV platform for the European market in order to connect content providers with users across all of Europe. We build apps for all web & mobile platforms including TVs.Our engineering department is hiring for multiple teams: React, Video Streaming, Player, Ads, GraphQL, Android, SRE and Data Science. You will have plenty of opportunity to get to know new teams and technologies, as we value end-to-end ...
onsite Hyderabad, India full-time 314w ago
reactazurereact-nativeflutterxamarin
Show description
Zuzu | Hyderabad, India | Senior Mobile Engineer | ONSITE | https://zuzu.inAt Zuzu, we are building a subscription platform to connect children with instructors to make a wide range of extra curricular activities more accessible to children and broaden their spectrum of learning. Our vision is to enable children to learn anything they are interested in.We are looking for a cross platform mobile Engineer (Xamarin, Flutter (or) React Native) and first engineer who is highly motivated to contribute...
onsite Sr. Software Engineer - Backend full-time 314w ago
Show description
Fleetsmith | Sr. Software Engineer - Backend | Onsite SF | Full-Time | Will gladly sponsor VisasFleetsmith automates device setup, intelligence, patching, and security, for your company’s Macs, iPhones, iPads, and Apple TVs. Our mission is to make powerful, secure Apple fleet management available to everyone.https://jobs.lever.co/fleetsmith/fde8a4da-9069-40c1-b5c7-b06...
remote Frontend Developer full-time 314w ago
javascripttypescriptgodartflutterweb3ethereumblockchain
Show description
Vocdoni | Frontend Developer | REMOTE Worldwide | Full-Time | https://vocdoni.io
Vocdoni is building an open toolset for anonymous and universally verifying voting, a participation platform and a sovereign identity scheme. Using Ethereum & Tendermint and ZK-SnarksAll our code is free open-source. Our open stack makes uses Golang, Flutter & web technologies (Typescript)--EXPERIENCEReactive frameworks, JS, TS or DartStrong background in responsive & multi-platform design.Experience integrating wit...
remote React, Android, Eng Manager full-time 314w ago
reactmachine-learningandroid
Show description
Memrise | React, Android, Eng Manager | UK | Full-Time, Remote UK-only, Visa sponsorship and relocation available | https://www.memrise.comMemrise gives people learning superpowers!We've got:* An impactful mission - Memrise helps users achieve confident, real-world language skills & connect with new cultures.* Exciting technical challenges for you to work on. We build for scalability & high availability; use machine learning powering real-world, user facing features; have big data to process and...
remote Full Stack Engineer full-time 314w ago
Show description
Stay Nimble | Full Stack Engineer | Anywhere +/-3 GMT | Full Time | RemoteStay Nimble is a fast-growing, social enterprise start-up building a unique digital career coaching platform to support millions through career change and to find their purpose in the new world of work. The platform guides people through a journey profiling their strengths, using machine-learning algorithms to suggest well-matched career options and directing them to access best-in-class learning and career coaching resour...
remote DevOps/SRE full-time 314w ago
Show description
Arweave | DevOps/SRE | Berlin, San Francisco, New York | Full Time | RemoteArweave is a new type of storage that backs data with sustainable and perpetual endowments, allowing users and developers to truly store data forever – for the very first time.As a collectively owned hard drive that never forgets, Arweave allows us to remember and preserve valuable information, apps, and history indefinitely. By preserving history, it prevents others from rewriting it.Hiring DevOps/SRE folks: https://stac...
onsite Geneve, Zurich, Taipei, Vilnius, Skopje ONSITE full-time 314w ago
iosandroid
Show description
Proton Technologies AG | Geneve, Zurich, Taipei, Vilnius, Skopje ONSITE | Full Time | Several openings | https://careers.protonmail.com/Proton Technologies AG is the Company behind ProtonMail [1] and ProtonVPN [2]. Head-quartered in Geneva, Switzerland, Proton is always at the forefront in the fight for privacy and a safe Internet.As we keep on extending ProtonMail and ProtonVPN, and we are building our new products - ProtonCalendar and ProtonDrive - we have several openings including Android, i...
remote Remote Only full-time 314w ago
Show description
Aula Education | Remote Only | GMT -1 / +2 | https://aula.educationAula is a social learning platform built for education. Aula replaces emails and learning management systems (e.g. Moodle, Canvas, Blackboard, D2L) with digital infrastructure designed to encourage conversation and participation. A digital campus that complements an institution’s physical campus, Aula enables new ways to teach, learn, and create community.To learn more about who we are, our engineering culture, and whether this i...
onsite San Mateo ONSITE full-time 314w ago
pythonjavascalareactrediscassandraaws
Show description
Apixio | San Mateo ONSITE | Frontend Tech Lead, Backend Tech Lead, Director of Engineering
At Apixio we are changing the way healthcare uses data. About 80% of healthcare data is under used because it is too messy or unstructured to efficiently analyze. The healthcare industry needs technology solutions that can process this data and extract insights.We are a profitable mid sized (less than 90) healthcare company. Our stack is React, Scala, Java, Python, Cassandra, Elastic, Redis. All on AWS.Ema...
remote SF, CA full-time 314w ago
javascripttypescriptpythonreactnodejsexpresspostgresqlaws +1
Show description
Outschool (YC W16) | SF, CA | Full Time | Senior Fullstackhttps://jobs.lever.co/outschoolWe inspire kids to love learning with live online classes, offered by independent teachers, conducted over Zoom video chat. We're scaling rapidly to support parents and teachers affected by school closures. Join us to build high-impact product features end-to-end, and to keep kids learning.We're pragmatic engineers, with a focused collaborative culture that encourages pairing (over Tuple these days) and iter...
onsite Full Stack Mobile Engineers full-time 314w ago
Show description
Klue (recently acquired by Medtronic) | Full Stack Mobile Engineers | ONSITE in San Jose, CA or Northridge, CA | Full-time | https://goklue.com/We are a digital health start-up developing wearable-based eating and drinking detection system. We were acquired by Medtronic in September 2019 and have an ambitious roadmap ahead to combine our technology with Medtronic’s systems to help millions of patients around the world.Klue’s automatic meal detection capabilities hold great promise for improving ...
onsite Stuttgart, Germany full-time 314w ago
javascripttypescriptkotlinreactpostgresqlmongodb
Show description
SPARETECH | Stuttgart, Germany | (Senior) Software Engineers | Full-time | ONSITE (Remote possible) |SPARETECH is a data driven spare part management startup.Our customers (top players in the automotive industry, among others) use our system to easily identify and purchase spare parts for their machines. We accomplish this by working with a data-driven modern technology stack with the aim of providing our customers with the world’s first-ever information retrieval system for machine spare parts....
London, UK full-time 314w ago
pythonmachine-learning
Show description
UK Dementia Research Institute at Imperial College London | London, UK | Full Time | R, Python, NextFlow, WDL, Bioinformaticshttps://www.imperial.ac.uk/jobs/description/MED01750/researc...I'm recruiting postdocs (research associates) to work with me on figuring out the biological proceses underlying Alzheimers and Parkinsons. I take a neurogenomics approach, mapping GWAS loci genome-wide onto cell type specific genome annotations [1]. We use advanced machine learning methods to extend the reach ...
remote REMOTE (USA) Senior Software Engineer (Backend) full-time 314w ago
typescriptreactnestjspostgresqlredistypeormawsdocker +3
Show description
Circadian Risk | REMOTE (USA)
Senior Software Engineer (Backend) | Full-Time
DevOps Engineer | Part-Time/Full-TimeCircadian Risk aims to improve enterprise security and physical risk mitigation.Package:* Competitive salary + equity incentive plan* Platinum PPO + vision + dental (including spouses/dependents)* Paid time offTeam:We are a hard-working team who loves building great products that improve people’s lives. We have an HQ in Ann Arbor, MI, but we try to keep our processes sensible, lightw...
remote Remote Global full-time 314w ago
javascripttypescriptphpelixirreactmysqldockerios +1
Show description
Automattic | Remote Global | Remote Only | https://automattic.comWe’re the people behind WordPress.com, Jetpack, WooCommerce, Tumblr, and more. We’re passionate about democratizing publishing so that anyone with a story can tell it, regardless of income, gender, politics, language, or where they live in the world. As CEO Matt Mullenweg says, “We’re building the operating system for a more open, integrated, and user centric web. With more than 1,000 people distributed over 75 countries, we’re con...
remote Senior Full Stack Engineer full-time 314w ago
javascriptvuenodejs
Show description
Reviewable | Senior Full Stack Engineer | REMOTE only | Full Time | https://reviewable.ioReviewable is a code review tool for GitHub that improves on pull requests. It has seen strong adoption among companies that prioritize thorough but efficient code reviews. The company is bootstrapped and has been profitable for a number of years. I'm now looking for the first full-time hire: somebody who could quickly take the lead on all technical aspects (development [JavaScript, Vue, Node, Firebase RTDB,...
Software Engineers and many more full-time 314w ago
pythonjavakotlingcpkubernetesterraformmachine-learning
Show description
Revolut | Software Engineers and many more | London, Krakow, Berlin, New York, Moscow, Vilnius | Full-Time | https://www.revolut.comRevolut is one of the fastest growing companies in Europe. We’re hiring throughout the company for many roles. I work on Data Platform, helping people bring ML models to production. We use Terraform, Kubernetes, GCP, Vault, Python, Java, Kotlin, Exasol and many more. There are a lot of interesting challenges and projects. We're looking for experienced engineers that...
remote Remote (Preferable India) full-time 314w ago
javascriptpythondjango
Show description
Horizon technologies | Remote (Preferable India) | Part-Time | Python | Javascript | https://horizontech.devHorizon Technologies is one of the leading student accelerators in India. Currently, looking for mentors who have experience building realtime applications in Python or Javascript for more than 2+ years.1. Horizon started in 2009 and trained 5000+ students.
2. Our ideal mentors are someone who is focused more on giving to the community and have a passion for learning.
3. Mentorship include...
Playa Vista, CA full-time 314w ago
javascripttypescriptreactnodejspostgresqlelasticsearchreact-nativerabbitmq +1
Show description
Wellth | Playa Vista, CA | Director of Engineering50% of chronic disease patients don't take their medications as prescribed. We motivate that 50% with a tech-enabled rewards program, delivered through a mobile app and image recognition back-end, by paying each person up to $30/month. That gets them back on track, healthy, and keeps them out of the hospital.We just raised a $7mm round and are positioning ourselves for the next two years of growth. We need you to come lead our engineering team to...
Software Engineers full-time 314w ago
machine-learning
Show description
Nines | Software Engineers | Full-Time | Palo Alto, CANines is the first-of-its-kind radiology service. Our radiologists and engineers are on a mission to build world-class tools to enable the best radiologists to deliver the best patient care. We’re co-founded by David Stavens, former co-founder and CEO of Udacity, and co-founder of Stanford University’s self-driving car team (acquired as the foundation for Waymo). With the support of iconic VCs Accel Partners (early Facebook, Spotify, Dropbox,...
remote Westlake Village, CA/Remote full-time 314w ago
Show description
BackNine Insurance | Westlake Village, CA/Remote | Fullstackhttps://back9ins.comWe simplify the selling of insurance. We’re a 3 person engineering team within a 25 person company with a growing product (https://intelligentquote.com). US talent only (compliance reasons).Email reid@back9ins.com
onsite full-time 314w ago
javascripttypescriptrustrubyscalaerlangreactrails +4
Show description
AdGear - ONSITE - Backend Engineer (Erlang, C, Rust, Go) - Montreal - FullTime
AdGear - ONSITE - Data Engineer (Scala, Spark, Kafka, Vertica, AWS)- Montreal - FullTime
AdGear - ONSITE - Javascript Application Engineer (TypeScript, React) - Montreal - FullTime
AdGear - ONSITE - Ruby Application Engineer (Ruby, Rails) - Montreal - FullTime
AdGear - ONSITE - Senior Machine Learning Engineer - Montreal - FullTimeFollowing its acquisition by the Visual Display division of Samsung in 2016, AdGear is n...
onsite Bangalore, India full-time 314w ago
vuedjango
Show description
Compile Inc | Bangalore, India | Fulltime | ONSITE | Fullstack/Frontend/ETLhttps://www.compile.com/careers/open-positions/
Compile is a completely self-funded company working on data. Our primary focus right now is Healthcare; we process large amounts of publicly available and real-world data to derive meaningful insights. Primarily a Django shop, our frontend is built on Vue.We're looking for frontend engineers who can also, over time, jump into the backend or help us in communicating the compl...
onsite Data Science & Eng Managers, Sr. Engineers & Sr. Data Scientists full-time 314w ago
pythonscalareactdjangoflaskpostgresqlawsdocker +5
Show description
Komodo Health | Data Science & Eng Managers, Sr. Engineers & Sr. Data Scientists | NYC & SF | Full-time, OnsiteKomodo Health is A16z-backed series C startup building data-science and ML-powered products to improve decision making in healthcare. Our mission is to reduce the global burden of disease through big data analytics. Our "healthcare map" is where we process data and stitch together information about patients (over 320M in US), doctors, hospitals, payers, etc.We are a data-first & eng-dri...
remote full-time 314w ago
Show description
Hey, a friendly note to remote job seekers!There are few automated aggregation sites available to curate the jobs posted in the "Who is hiring?" thread but I want to take the aggregation one step further and wanted to provide the good quality remote jobs by handpicking them. I’m going to search, screen, verify and tag all the
remote jobs posted in the other Who is hiring? thread. So it can save you time, energy, and frustration – and hopefully, help you find a job
faster during this tough time!h...
Cambridge, MA full-time 314w ago
rust
Show description
Akamai | Cambridge, MA | Full timeRole: Principal Software EngineerDescripton: The Enterprise Security space is thriving and Akamai is leading the way in exciting new areas! We are looking for a Principal Software Engineer to help develop a new product that will continue to drive Akamai’s Zero Trust platform as the world-wide leader. You will be crucial in the architecture and development of a new best-in-class security product working on everything from protocol design to implementation.We're u...
remote full-time 314w ago
rubyrailsmongodbiosandroid
Show description
Main street computing, we develop and support opencaseware, remote, based in Buffalo new York, jobs at mainstreetcomputing Dot com. Ruby / rails, Mongo, native ios and Android.
full-time 314w ago
Show description
don't apply here. Waste of time and effort. They will ask you to do presentation of the your work etc. They can't pay. Despite knowing that they still interview you and waste your time.
remote Remote and many US and European Cities, Pune, IN and Australia and other places full-time 314w ago
linux
Show description
CrowdStrike | Remote and many US and European Cities, Pune, IN and Australia and other places | Many Positions | https://www.crowdstrike.com/careers/CrowdStrike is hiring aggressively.My team managers the physical and virtual server infrastructure.I'm looking for:Data Center Technicians (non remote)Power Analysts (looking at server, pdu, DC power - remote)HW Performance Testers (server, cpu, disk performance analysis - remote)Linux Automation (remote) VMWare Administrators (highly advanced in la...
remote Remote full-time 314w ago
rustrubyelixir
Show description
Nightwatch.io | Remote | Full-time | Elixir, Rust, Ruby, GoThis is a fully remote position, full-time or part-time, with flexible working hours and work arrangements.We’re looking for an experienced developer who enjoys working with server side technologies and possesses a good mixture of DevOps and application development chops, has been around the block a couple of times, and would like to build forward-thinking and innovative solutions with experienced teammates in a progressive-oriented envi...
full-time 314w ago
Show description
don't apply here they waste your time despite doing all the interviews well.
San Francisco, CA; Mountain View, CA; Dublin, Ireland; Ankara, Turkey full-time 314w ago
javascriptpythonreactnodejsdjangomysqlrediscassandra +4
Show description
Udemy | San Francisco, CA; Mountain View, CA; Dublin, Ireland; Ankara, Turkey | Full stack, Data science | https://about.udemy.com/careers/Udemy is an online education marketplace that provides online education services to individuals, businesses, and governments around the world. We have tens of millions of actively-engaged students with 150,000 courses currently available, in 65 languages. The majority of our courses are on technical skills, but our instructors teach courses on thousands of to...
remote Redwood City, CA and REMOTE full-time 314w ago
elixirerlang
Show description
Shoreline.io | Redwood City, CA and REMOTE | Software Engineer (Distributed Systems) https://app.trinethire.com/companies/22646-shoreline-softwar...Shoreline was founded to reduce operational pain. We have experience building and operating mission critical databases, cloud services with millions of hosts, and self tuning feedback control systems. We want to reduce tickets and improve availability by an order of magnitude through automation. We are well funded and based in Redwood City, Californi...
Engineering, Product Management, Design full-time 314w ago
typescriptpythongoelixirawskubernetes
Show description
Brex | Engineering, Product Management, Design | SF, NYC, VancouverBrex is building the next generation of B2B financial services with better tech and without the restrictions of outdated legacy banking technology, starting with corporate cards for startups. We’re looking for engineers, product managers, and product designers who want to be part of a team that believes that taking the time to make a thorough decision matters, where pride in our craft is a defining characteristic, and who are opt...
USD 120k-220k/yr remote Engineer full-time 314w ago
javascripttypescriptc#react
Show description
Game Closure | Engineer | SALARY: $120k - $220k | REMOTE preferred | VISA ok San Francisco Bay area (SF) | Tokyo, Japan | Seoul, KoreaGame Closure is profitable, recently raised $40M, and we know how to hire and work remotely, which has been our primary mode of operation for the past 2 years. We are still scaling up during this time, especially with the increase in great engineers who will now consider remote work.Game Closure is building the world's most advanced javascript game technologies, i...
onsite Nashville, TN full-time 314w ago
javascriptnodejsawsazure
Show description
Very Real Help | Nashville, TN | Backend Software Engineer | Fulltime | Onsite or RemoteVery Real Help is developing a social VR application that will be widely accessible to millions of people who struggle from mental health issues. We will provide immediate, 24/7 access to mental health support through fun immersive environments. Last year, more than 70,000 people died from drug-related overdose deaths, and over 50 million people experienced depression and anxiety. We believe that VRH can addr...
NYC - NY City, NY full-time 314w ago
Show description
Level | NYC - New York City, NY | https://level.com/Level is a financial services company that’s reinventing employee benefits, starting with the $100B+ dental insurance industry. With our own payments stack and an insurance network built from the ground up, Level offers a better way for people to use and pay their benefits while helping employers control costs. Our founding team comes from companies that have simplified payments and insurance—like Square, Oscar Health, Mercer, and Uber. Based i...
remote Part-time full-time 314w ago
javascriptrailsmachine-learning
Show description
SEEKING FREELANCER/CONSULTANT | Part-time | SF Bay Area | Remote- Product -Hotpot.ai (https://hotpot.ai): graphics for apps, extensions, and startups. (If you want free graphics, ask for a promo code. Happy to help HN.)- Editor Work -Improve web-based editor. Many hard problems if you enjoy pixels and graphics.- Editor Requirements -Expertise in JavaScript, HTML, and SVG. Passion for math and pixels, and an openness toward loving their neglected cousin, fonts.- ML Work -Use ML to simplify proble...
remote full-time 314w ago
Show description
Protocol Labs is hiring a REMOTE Research Engineer for our new Resilient Networks Lab (https://research.protocol.ai/research/groups/resnetlab/).Job description can be found here: https://jobs.lever.co/protocol/f39f7fe0-1805-40d2-9453-90fd2...ResNetLab supports the research efforts of two of Protocol Labs' flagship projects: IPFS and libp2p. Its mission is to build resilient distributed systems, by creating and operating a platform where researchers can collaborate openly and asynchronously on de...
full-time 314w ago
Show description
AirGarage raised $2m from Founders Fund and Floodgate to build smarter cities by automating parking. Our vision is to turn parking lots into multi-use hubs - farmers markets, parks, food trucks, and vibrant spaces.Software Engineering, Marketing, Sales
https://airgara.ge/careers
onsite Orange County, Los Angeles, Novato Software & Graphics Engineers, Artists
Full-Time full-time 314w ago
c#
Show description
Visual Concepts | Orange County, Los Angeles, Novato Software & Graphics Engineers, Artists
Full-Time | Onsite (Remote/WFH during current crisis)https://vcentertainment.com/Visual Concepts has been a driving force in the videogame industry for more than 30 years. We have made some of the coolest and most high profile games anywhere, across almost every conceivable hardware platform, and are dedicated to putting the consumer first through great technology, innovation and passion for true excellen...
remote Data Scientist / Software Engineer full-time 314w ago
machine-learning
Show description
General Dynamics Mission Systems / Deep Learning Analytics Center of Excellence | Data Scientist / Software Engineer | DC area / REMOTEMachine learning / deep learning research and implementationJob req posted at three experience levels:http://bit.ly/dlateam
remote Senior Mobile Engineer full-time 314w ago
reactreact-nativeiosandroidethereumblockchain
Show description
MetaMask | Senior Mobile Engineer | Remote | https://metamask.ioMetaMask empowers users and builders to transact, raise, share, transfer, invest, coordinate and distribute value via the decentralized web. We aim to bring our 1 million+ users a private, secure, robust and delightful user interface for the ethereum blockchain.In 2019, we launched our mobile web browser and gained rapid traction. We are hiring a Senior Mobile Engineer to help lead technical development as we aim to engage and empow...
remote Multiple Openings full-time 314w ago
Show description
Simbe Robotics | Multiple Openings | South San Francisco | remote while Covid-19 requires it - onsite after |Simbe is building Tally, an autonomous mobile robot for the world's retail industry. Tally is rapidly growing a world-wide customer base by helping in-store teams to collect and analyze on-shelf product data and providing actionable insights.https://www.simberobotics.com/about/careers/apply
onsite Senior Engineer full-time 314w ago
javascripttypescriptpythonrubyvuerailsawsdocker +3
Show description
Blue Canvas | Senior Engineer | Berlin, flexible on-site | https://bluecanvas.ioWe make source control and DevOps tools for the Salesforce dev ecosystem. We were shocked to learn that Salesforce devs and admins build impressively complex applications without any kind of source control or CI! The market is growing fast as more companies embrace “low code” platforms like Salesforce ($13B was spent customizing Salesforce in 2017).We’ve reached profitability working with initial customers like Sysco...
onsite San Francisco, CA full-time 314w ago
clojurereactpostgresqlawsgit
Show description
Treasury Prime (YC W18) | San Francisco, CA | Onsite | https://treasuryprime.comTreasury Prime is transforming banking for the 21st Century. We partner with banks to build the technology to enable this new wave of fintech startups. Through simple, unified APIs, we are modernizing the economy.To learn more about who we are, our engineering culture, and whether this is the right place for you, read our Key Values profile: https://www.keyvalues.com/treasury-primeHere are our open roles:- Senior Sof...
onsite Multiple Openings full-time 314w ago
pythonmachine-learninglinux
Show description
Brain Corporation | Multiple Openings |San Diego, CA | Mostly OnsiteBrain Corp is a San Diego-based AI company that specializes in the development of self-driving technology. We are taking our proprietary BrainOS (robot operating system) and putting it on other company’s machines to turn them into self-driving, autonomous robots. We have raised $110m from SoftBank and Qualcomm Ventures.We have recently announced partnerships with Walmart in the US and Softbank Robotics in Japan and have thousand...
remote San Francisco / Palo Alto for internships, REMOTE option for contractors full-time 314w ago
pythonpytorchmachine-learning
Show description
Pinterest Visual Search / Applied Computer Vision | San Francisco / Palo Alto for internships, REMOTE option for contractors | Applied ML Internships / full stack ML infrastructure engineering contracting rolesThe Visual Search team works on all aspects of applied computer vision at Pinterest and is offering summer 2020 internship opportunities, along with contracting roles for industry veterans who are looking for a flexible arrangement. This is a full stack team, ultimately driven to ship user...
onsite Software Engineer, Engineering Manager full-time 314w ago
python
Show description
Cisco Umbrella | Software Engineer, Engineering Manager | San Jose, CA | Onsite Full-TimeCisco Umbrella is building a cloud based Secure Internet Gateway. The team building the Secure Web Gateway component is looking for software engineers and an engineering manager. You will be building microservices which provide security to and proxy web traffic. I'm an engineer in the team and can vouch the work and people are awesome.Apple here
- Senior Software Engineer (C/Go/Python) https://jobs.cisco.com...
onsite Full Time full-time 314w ago
Show description
Songspace | Full Time | | Nashville USA or Amsterdam NL | Onsite or Remote | https://songspace.comSongspace’s mission is to streamline creative and business workflows that contribute to a more efficient and transparent music industry. Foremost, Songspace is a catalog management and pitch tracking SaaS, combining features from Dropbox/Box, iTunes, GoogleDocs and SoundCloud in one product. Secondly as a tool that enhances the workflows across a team or group, Songspace empowers all users to have c...
onsite Singapore or San Francisco full-time 314w ago
reactgatsbynodejspostgresqlredisawsgcpreact-native +4
Show description
Taskade (YC S19) | Singapore or San Francisco | Onsite or Remote | [https://taskade.com]Taskade is building real-time organization and collaboration for remote teams. Manage tasks, write notes, and video chat, in one unified workspaces.We are reimagining the future of work, remote collaboration, and team productivity. Our mission is simple, to help teams get work done, faster and smarter.Here is our story: https://taskade.com/aboutOur team updates: http://blog.taskade.comHere are our open roles:...
onsite Seattle full-time 314w ago
awskubernetes
Show description
Amazon Web Services - EKS | Seattle | Full time, onsite (but virtual for now due to COVID-19) | https://aws.amazon.com/eks/We’re a relatively new team of AWS engineers that are building a core set of services to help our customers to run and use Kubernetes and etcd at scale on AWS. CNCF in 2017 found that 60%+ of Kubernetes workloads run on AWS. Given the massive scale and customer demand on Amazon EKS, it is is our goal to contribute upstream to strengthen the design, scale, security and stabil...
onsite software engineer / ML / computer vision full-time 314w ago
machine-learning
Show description
Allen Institute for Cell Science | software engineer / ML / computer vision | ONSITE Seattle | Full-timeThe modeling team at the Allen institute for Cell Science is hiring for two software engineering positions -- a data generalist and a ML / computer vision specialist:https://alleninstitutecellscience.hrmdirect.com/employment/j...
https://alleninstitutecellscience.hrmdirect.com/employment/j...ONSITE, SeattleThe Allen Institute for Cell Science aims to impact the entire cell science community. O...
remote Seattle (Remote until post-COVID19) full-time 314w ago
pythonjavanodejsawsiosandroidlinux
Show description
AWS Developer Tools | Seattle (Remote until post-COVID19) | Developer | Full-Time | ONSITE | https://aws.amazon.com/products/developer-tools/AWS Dev Tools builds the tools that we all use for software development and CI/CD ... at least some of them :-). I'm leading a team (CodeStar) of impassioned developers trying to re-invent how we create, release, and iterate on software quickly and safely.We're looking for engineers to build this out! If you have experience with different languages (Python,...
onsite NYC full-time 314w ago
iosandroid
Show description
Justworks | NYC | Multiple Engineering Roles | Full Time | On-Site (WFH during COVID)Justworks helps businesses get off the ground by enabling them to focus on running their business. We help level the playing field for small businesses by giving them access to corporate-level benefits, payroll and HR tools, at more affordable rates.We're actively hiring for a number of different teams and roles - both engineers (incl. frontend, backend, full-stack, iOS/Android, DevOps) and engineering managers....
remote Multiple ClickHouse engineering positions full-time 314w ago
clickhouse
Show description
Altinity | Multiple ClickHouse engineering positions | REMOTE in North America and Europe| Full-time | Competitive Salary and EquityHello! We are Altinity, a fast-growing database startup with a distributed team spanning from California to Eastern Europe. Our business is to make customers successful with ClickHouse, the leading open source data warehouse. Our customers range from ambitious startups to some of the most well-known enterprises on the planet. And we are looking for people to join us...
onsite Redwood City, CA full-time 314w ago
typescriptpythonreactmachine-learningsass
Show description
Course Hero | Redwood City, CA | Various Engineering, Product, Design roles | Full-time, Onsite, Visa | https://grnh.se/2ywlpfCourse Hero is an online learning platform where students can access over 40 million course-specific study resources contributed by a community of educators and other students. We envision a world where every student graduates, confident and prepared.Our tech stack: React, Typescript, Sass, Go, PythonWe are hiring for the following roles:
- Senior/Staff/Lead Software Engi...
onsite Head of Engineering full-time 314w ago
Show description
Valora Digital | Head of Engineering | Full-time | Zurich, Switzerland | ONSITEValora Digital is the newly founded digital unit of Valora, a European retailer with 2700 stores across 5 countries. We are tackling interesting challenges in areas such as Autonomous Stores (think Amazon Go), Ecommerce & Delivery, Loyalty, Payments and Process Improvement. For this purpose we are building up a development team from the ground up. You will be one of the first engineers and will have a big part in shap...
remote REMOTE full-time 314w ago
machine-learninglinux
Show description
Ferrum Health | REMOTE | Full Time | Senior Backend Engineer | https://ferrumhealth.comMedical errors are the third leading cause of death in the US, and Ferrum builds AI-powered monitoring systems to help health systems detect and address mistakes before they affect patient care.Ferrum is a fully remote and distributed company focused around the US and European timezones. Since launching its first offering for lung cancer errors two years ago, Ferrum now covers over 10 million patients at nine ...
onsite Brisbane, Australia full-time 314w ago
javascriptdartflutterxamarin
Show description
Code Heroes | Brisbane, Australia | Full-time | Onsite | https://www.codeheroes.com.au
Our stack: Flutter / Dart, Xamarin / C#, Firebase, JavaScriptCode Heroes are a small mobile app company based in Brisbane focusing on mobile application development for medium to large companies. We are currently actively looking for experienced developers that have hands on experience with Flutter (Dart), or those with mobile app development history and a willingness to learn.The job is full-time and onsite w...
full-time 314w ago
javascalaaws
Show description
BoardREhttps://board.live/Our startup is fast-moving and high-energy, and we are looking for someone who can rise to the occasion, well beyond the typical 9-5. This is a job for the bold and daring person who can collaborate with fellow engineers to help us take BoardRE to the next level by building a modern and unprecedented kind of real estate and mortgage banking platform. Our team is very energized and is dedicated to pursuing an impressive long term vision. We’re a Silicon Valley funded sta...
onsite Senior / Software Engineer full-time 314w ago
pythonrubyreactrailsmysqloracleawssnowflake
Show description
DataGrail | Senior / Software Engineer | San Francisco, CA | Onsite / Remotehttps://datagrail.io/careersHelp us build data privacy as a service.Data privacy / data protection should be a no-brainer, but the reality is that many organizations were not built with privacy in mind (the HN crowd knows all too well), so we're looking to make this not suck. In doing so, we'll give consumers better control over their data without all the needless hurdles one currently confronts.Our stack (and growing):*...
remote Los Angeles, and REMOTE USA/CANADA full-time 314w ago
Show description
Zelos.gg (YC W20) | Los Angeles, and REMOTE USA/CANADA | Frontend / Fullstack | https://zelos.ggZelos is a rewards program where gamers earn points and redeem in-game prizes across multiple games. When you play your favorite game, simply finish a challenge (e.g. get 3 kills) to earn points and trade in your points for a prize (e.g. a new game or a skin).We built Zelos because games today focus on monetizing off their most dedicated players (whales). For gamers like us who play multiple games, sp...
onsite software engineers full-time 314w ago
javascriptrubyreactrailspostgresqlredis
Show description
GiveCampus (YC S15) | software engineers | Full Time | Washington DC | On-site (remote for now) | https://jobs.lever.co/givecampusWe recently just announced free use (minus payment processing) of our Giving Forms product to all non-profits raising money to to help with COVID-19 issues. Check https://go.givecampus.com/gf-covid-19/ for more details.GiveCampus builds fundraising software for colleges, universities, and K-12 schools. The company is 5 years old, profitable, and serves more than 800 s...
remote full-time 314w ago
pythonreactrailsreact-native
Show description
I run a dev shop called Bauhaus Labs (bauhauslabs.com) we build mobile and web apps. Looking for extra hands on deck, open to part time, REMOTE, and INTERNS. If you have exp with react, react native, rails or python, hit me up! Email is contact@bauhauslabs.com
remote REMOTE/ONSITE full-time 314w ago
ruby
Show description
Pioneer | REMOTE/ONSITE | Good Engineer | https://pioneer.appFounder of Pioneer here.We're building a fully remote online accelerator. A kind of YC-before-YC. We find people on the Internet that seem promising and give them "Silicon Valley", but on the Internet. It's a lot of gamification, Ruby software, Zoom, Slack, and fun. We've funded over 100 people around the world in 30+ countries. We direct them to YC once they graduate. (Tbc, we have no formal attachment to YC; just admiration. And a se...
onsite full-time 314w ago
reactnodejs
Show description
ONSITE on Abbot Kinney, Venice Beach, LA Los Angeles (but remote for now) & ONSITE or REMOTE in Florianópolis, Brazil.AE Studio is looking to hire1. software developers with sufficient social skills to communicate with some interesting clients2. full stack devs with plenty of experience with node and react and an ability to pick up new things fastThe first is a hybrid individual contributor/manager role with a lot of interesting challenges involved. We've found that the people who succeed best i...
remote REMOTE full-time 314w ago
swiftobjectivecios
Show description
Highrise | REMOTE | Senior iOS Developer | https://jobs.lever.co/highriseHighrise is a mobile game and community that generates meaningful human connections on a massive scale so that everybody can enjoy a profound sense of belonging. In Highrise, people can make avatars, design art and environments and meet new friends. We are building on the spirit of applications like Animal Crossing, The Sims, Habbo Hotel and Second Life.Over 3 million people create avatars, chat and make friends in Highrise...
full-time 314w ago
ruby
Show description
Cleo was created to improve your financial health.Already, she’s helped 3 million people improve their relationship to money with simplicity and a sense of humour.She’s not a bank though. She’s an interface for the 99% – an AI assistant defining a new category, one that goes beyond saving up to actually changing how we feel about our finances.Through chat, she provides you with deep insights about your money, while suggesting personalised financial products that increase your ability to save. Bu...
onsite Various SW & HW Roles full-time 314w ago
Show description
Red Leader Tech | Various SW & HW Roles | Palo Alto, CA | Onsite Full-TimeRed Leader Tech is building a lidar sensor that offer 10x resolution and 2x the range over current products in development or on the market. We're leveraging advances in signals processing and the unique properties of light to offer a "1080p" 3D camera when other sensors have resolutions equivalent to the Gameboy Advance SP.We’re an early stage venture-backed startup (team of 4) with significant technical traction (first p...
remote Pleasanton, CA & San Francisco, CA full-time 314w ago
typescriptrustreact
Show description
10x Genomics | Pleasanton, CA & San Francisco, CA | Various Engineers & PMs | https://www.10xgenomics.com/careers/ | US RemoteScientists are using our technology to make discoveries and guide COVID-19 therapeutic development. There have been a number of recently published pre-prints using single cell genomics to study infection, response, and potential drug targets. For example, Vanderbilt University’s Vaccine Center is using our immune profiling technology to discover antibodies from survivors ...
remote Rails / React / Security full-time 314w ago
rubyreactrails
Show description
Aha! (https://www.aha.io) | Rails / React / Security | REMOTEAha! is the #1 tool for product managers to plan strategy and roadmaps. We serve more than 300,000 users worldwide.We are looking for:* Experienced full-stack engineers to work on the Aha! product. Our application is built in Ruby on Rails, with some React on the frontend for rich client-side experiences.* Security engineers, with hands-on Rails development experience plus experience with compliance projects, security policy developmen...
onsite Multiple roles full-time 314w ago
Show description
Nylas | Multiple roles | Multiple ONSITE locations | Full-timeNylas is the only unified communications platform that allows developers to connect to every email, calendar, and contacts provider in the world.The Nylas Universal APIs are secure, reliable, and easy to use. With a single integration that can be completed in days, pre-built security and compliance features, and a 99.99% guaranteed uptime, Nylas removes the complexity of building and maintaining direct integrations with Gmail, Outlook...
remote https://getclockwise.com full-time 314w ago
machine-learning
Show description
Clockwise | https://getclockwise.com | San Francisco (SF Bay Area) | currently REMOTE but ONSITE after shelter in place lifted | Product Hunt's #2 Product of the Year 2019 Clockwise is creating the first intelligent calendar system by leveraging Machine Learning & Artificial Intelligence.
We've raised >$13M with Series A funding from Greylock, Accel, Slack Fund, etc.We are looking for a first Product Marketer as well as a Product Designer to join our current team coming from RelateIQ, Salesforce...
Philadelphia, PA full-time 314w ago
Show description
Cesium | Philadelphia, PA | UI/UX Developer | cesium.com/careersCesium is an end-to-end geospatial platform that unleashes the potential of 3D data by making it easy for developers to visualize, analyze, and share 3D content.We’re looking for a front-end UI/UX engineer to design and build elegant interfaces and effective workflows for our products. You’ll embed with our engineering teams to help craft intuitive workflows, improve the UX/UI design or our tools and custom apps - and then turn thes...
remote Remote and VISA full-time 314w ago
Show description
FullContact | Remote and VISA | Denver |Principal Algorithm Engineer |Sr. Data Engineer | https://www.fullcontact.com/careersFullContact is the premier provider of SaaS-based identity resolution that empowers brands to improve their customer experience and authentically engage with consumers.We're hiring for 2 leadership roles on our identity resolution team. This team is helping us change the data landscape and we're looking for bold engineers who are comfortable with big data technology. These...
remote Account Executive full-time 314w ago
Show description
RAINCLOUD | Account Executive | Austin, TX | remote | Full TIme | www.rncld.comRAINCLOUD provides top of funnel lead generation to technology companies. We create conversations and set meetings/demos.We're 2 years old, based in Austin yet fully distributed with people in Canada, Spain, Ukraine, USA, and IndiaLooking for more Rainmakers whose job is to outbound (phone and email) to generate interest in the products and services our clients offer. Great gig for people who love tech but aren't engi...
onsite London, UK full-time 314w ago
javascripttypescriptreactnodejsgcpkubernetesmachine-learningreact-native
Show description
Velocity Black | London, UK | Senior Software Engineer
VISA | ONSITETypeScript, Node.js, React/React Native, Google Cloud Platform and KubernetesVelocity is a rapidly growing, but mature startup. We are building new and innovative technologies for a niche, but profitable, industry. Products include precise, enterprise grade SaaS systems, consumer and customer agent apps, white labelling and SDKs, voice control and AI/ML recommendation logic.Great opportunity for talented engineers, competitive s...
remote Chicago, IL or Austin, TX or San Francisco, CA or REMOTE USA full-time 314w ago
Show description
Braintree / Paypal | Chicago, IL or Austin, TX or San Francisco, CA or REMOTE USA | Software Engineer | https://www.braintreepayments.com/careers/Braintree lets you move money from one place to another safely and securely. Every time you pay for an Uber ride, book a stay through Airbnb, or pay with PayPal when you check out online, you're probably using our product. We solve world-scale problems and provide opportunities to match. We build diverse teams that recognize our strengths and allow us ...
onsite Full Stack Developer full-time 314w ago
c#nodejsaspnetpostgresqlredisawsterraform
Show description
ProcedureFlow | Full Stack Developer | Saint John, NB, Canada | ONSITE | REMOTE in Eastern Canada | Full-Time | https://procedureflow.comProcedureFlow allows you to turn your company's procedures and expert information into small, hyperlinked flowcharts that are easy to follow and maintain. We're like GitHub but for visual procedures.ProcedureFlow has a lot of great paying customers that consider us vital to their business. We're growing our development team as we start to scale. We've more than...
remote Online ordering for restaurants - think Shopify for hospitality full-time 314w ago
Show description
Flipdish | Online ordering for restaurants - think Shopify for hospitality | Dublin, Ireland | High growth startup of 100 peopleHiring .NET backend developers. REMOTEAll roles at https://www.flipdish.com/careers/
remote https://serpapi.com full-time 314w ago
javascriptrubyreactrailsmongodb
Show description
SerpApi | https://serpapi.com | Senior Backend Engineer | Austin, TX | Full-time | REMOTE FIRST COMPANYSerpApi is a real time API to access search engine results. We solve the issues of having to rent proxies, solving captchas, and JSON parsing in an easy to use and integrate API for our customers.Our current stack is Ruby, Rails, MongoDB, and React.JS. We are looking for a senior backend developer. Experience in Ruby, Javascript, Proxies, CAPTCHA solving, or Browser tech are definitely pulses.W...
Toronto, Canada full-time 314w ago
Show description
Relay Platform | Toronto, Canada | Quality Assurance Engineer | https://www.relayplatform.com/careersRelay is an online Software-as-a-Service solution helping ceding teams, insurance underwriters, MGAs and brokers to structure and secure reinsurance and large insurance placements simpler and faster. It sounds complicated (and is!) but you don't need to be a reinsurance expert - we'll teach you what you need to know.We're hiring a QA Engineer to bring our feature and regression testing in house. ...
remote SF or Remote full-time 314w ago
Show description
UCSF Data Science CoLab|SF or Remote|Back-end, Front-end, Full-stack|dscolab.ucsf.eduWe are building our engineering team for our Data Library project, a platform to house, process, and visualize biological data for biologists at UCSF towards identifying diagnostics and treatments for disease (cancer, autoimmunity, infection). Looking for engineers who are inspired by this mission, and who have experience in either front-end (plotting/viz and UI/UX is a plus), back-end, or full-stack development...
remote Miami, FL and REMOTE USA full-time 314w ago
nodejs
Show description
Genetic Networks | Miami, FL and REMOTE USA | Computer Information Research ScientistGenetic Networks combines pharmacogenomics and functional genomics to provide solutions to the pharmaceutical and healthcare industries. Our proprietary platform technologies overcome the weakness of single gene analyses by analyzing genes and drugs in the context of functional genetic modules. Genetic Networks’ platform technology uses the conservation of modules between humans and model organisms to deliver in...
onsite Full-Stack Engineers (3) full-time 314w ago
typescriptrubyreactrailsgraphql
Show description
XCLAIM | Full-Stack Engineers (3) | Full-Time, Onsite/Flexible | Los Angeles, CA | https://www.x-claim.com | https://jobs.lever.co/x-claim/4d8ca469-3225-45fb-9d9b-c5231c...We are looking for full-stack engineers who want to help us disrupt the bankruptcy claims trading market. On its face, that doesn't sound too exciting, but this might help: the value of the trading market is roughly $500,000,000,000 pre-recession.We are pre-production.Our stack is Ruby on Rails, GraphQL, React/Redux (TypeScrip...
onsite Berkeley, CA (San Francisco Bay Area) full-time 314w ago
machine-learning
Show description
Covariant (https://covariant.ai/) | Berkeley, CA (San Francisco Bay Area) | full-time | onsiteOur mission is to build the Covariant Brain, a universal AI to give robots the ability to see, reason, and act on the world around them. Bringing AI from laboratory research to the infinite variability and constant change of our customers' real-world operations requires new ideas, approaches and techniques.We were recently featured in publications from the New York Times (https://nyti.ms/2SkFoUe) and th...
remote Senior Data Science/Full Stack/Backend/Android/iOS/QA positions full-time 314w ago
pythonswiftkotlinreactawsiosandroid
Show description
Noom | Senior Data Science/Full Stack/Backend/Android/iOS/QA positions | REMOTE or HQ | FULL-TIME | https://noom.comAt Noom, we use scientifically-proven methods to help users get a handle on chronic medical conditions like obesity, diabetes, and heart disease. We use a variety of technologies, and get to work on hard problems that range from data warehousing to running experiments on mobile devices.Our engineering team is expanding, and we have openings for a number of positions that include ba...
remote Remote full-time 314w ago
javareactspringmongodbgcp
Show description
Syncari|Remote|UI & Backend EngineersSyncari is a distributed SaaS data management platform for customer & revenue data. We are a VC funded early stage startup and are fully remote.We are looking for driven engineers who know Java(Spring,MongoDB, GCP) or UI(react/redux) very well.Reach us at jobs@syncari.com
onsite San Francisco full-time 314w ago
Show description
Rescale | San Francisco | ONSITE | Some roles open to REMOTE | https://jobs.lever.co/rescale
Rescale offers a software platform and hardware infrastructure for companies to perform scientific and engineering simulation. (We're an HPC/Supercomputing Cloud Platform) We are a Y Combinator startup with top investors: Jeff Bezos, Sam Altman, Paul Graham, Peter Thiel, & a bunch of others. I think we're now #39 on the Top YC list. We have about 150 employees scattered around the world, with about 28 so...
remote Security Analyst full-time 314w ago
Show description
Hinge Health | Security Analyst | San Francisco, CA or Portland, OR | REMOTE (only during COVID-19 pandemic, FT remote possible) | https://www.hingehealth.com/careersAs a healthcare company providing pain relief and alternatives to surgical treatment for those with chronic musculoskeletal (joint) pain, we play a critical role during the pandemic to help people stay healthy, safe, and calm. We do this by delivering a mobile app, motion sensors, and a remote health coach with zero direct human int...
remote Remote (North America) full-time 314w ago
javascriptrubyreactpostgresqlredissqliteawsdocker
Show description
Aptible (YC S14) | Remote (North America) | Remote OK | https://www.aptible.comWe're working to make information security a core competency of every startup. We envision a world in which startups have access to great information security, are empowered to focus on their business instead of on compliance, can scale faster and more efficiently, and are confident that they're creating quality products.To learn more about who we are, our engineering culture, and whether this is the right place for y...
remote Software Engineer full-time 314w ago
clojurereact
Show description
Metabase | Software Engineer | San Francisco, CA | REMOTE or ONSITE, FULL-TIME | http://www.metabase.com/We’re a small well-funded team building beautiful open source business intelligence tools used by over 17,000 companies.React frontend, Clojure backend. Most of the work we do is open source. We’re looking to hire strong frontend, backend, generalist, and sales engineers.If you love open source, building beautiful products, and working with data, apply at http://www.metabase.com/jobs
onsite San Francisco and Paris full-time 314w ago
pythonreactnodejs
Show description
Ava (www.ava.me) | San Francisco and Paris | FullStack, Software & Backend Engineers, Product Designer | ONSITE (in 9 months, can be REMOTE until then) | Positions: http://www.ava.me/jobsWe're a unique breed: a deep tech (4 PhDs), mission-driven (100,000 deaf/hard-of-hearing users relying on our work) and VC-funded startup (SV Angel, Initialized, Khosla), and we're doubling our team to 15.Our goal is to improve how we humans connect & communicate with each other using human & artificial intellig...
San Francisco, CA full-time 314w ago
Show description
Kong Inc | San Francisco, CA | Full Stack Engineer | https://konghq.com/We are a group of makers, thinkers, and doers focused on helping today’s developers build tomorrow’s technology. Our teams work on the bleeding edge of API innovation to provide our users with a central nervous system for data and services.Open Roles:- Senior Full Stack Engineer: https://jobs.lever.co/kong/13f58fac-1bd3-401b-95c1-cc48bfdb9...- Full Stack Engineer: https://jobs.lever.co/kong/f28182b4-bbb0-4d0d-9363-78496f1d0....
USD 120k/yr remote REMOTE will be considered full-time 314w ago
Show description
Synthetic Minds (YC S18) | REMOTE will be considered | $120k+ | All engineering teamSynthetic Minds is building program synthesizers, i.e., automation that can write code. Think of what we are building as a compiler that takes code and translates it to theorem proving, so that we can build automation that can understand code almost as close to a human. If it can understand code, with sufficient compute it can even synthesize it.For the kinds of technical problems we handle, look at https://synth...
onsite Cologne or Berlin, Germany full-time 314w ago
javascriptphpreactvueangulardocker
Show description
Healex | Cologne or Berlin, Germany | Full-time | ONSITE | Experienced Product Owners
https://healex.systems/en/jobs/Healex is hiring experienced product owners and product managers, ideally with a background in digital health care, to work on our platforms for clinical trial management, clinical research and connected healthcare with FHIR. Healex is a digital health startup from Cologne, developing platforms for clinical trials, clinical documentation, clinical research and FHIR based infrastru...
onsite Toronto, Canada full-time 314w ago
pythonreactdjangomysql
Show description
Top Hat | Toronto, Canada | Full Time | ONSITE (WFH currently due to covid) | Python, Django, MySQL, React | https://tophat.com/careersWe're a high-growth, Series D funded, EdTech company making the classroom more interactive and engaging for both students and professors. Top Hat is changing the education market by providing an innovative end-to-end solution, from interactive textbooks to location-based attendance, so professors can make learning fun and effective. You’ll be able to work in a dy...
onsite San Francisco, CA full-time 314w ago
javascripttypescriptreactnodejsexpresspostgresqlawsdocker +4
Show description
Point (YC W19) | San Francisco, CA | Onsite | https://www.point.appPoint is reinventing the way people spend money and discover their favorite new services and brands.We are backed by Y-Combinator amongst a list of other notable investors, are a team of talented product, engineering, and design oriented people with experience working at established companies and startups like Apple, American Express, Acorns, HotelTonight.To learn more about who we are, our engineering culture, and whether this i...
remote full-time 314w ago
Show description
TrueAccord is hiring engineers (SF, Kansas City, San Jose, remote) and product - two PMs, one Director of Product, and VP of Product.https://jobs.lever.co/trueaccord
onsite Santa Cruz, CA full-time 314w ago
typescriptrubyreactrails
Show description
Jane | Santa Cruz, CA | Onsite | https://www.iheartjane.com | Will relocateJane Technologies, Inc. has developed the cannabis industry's first real-time marketplace, where consumers can discover and order cannabis online. We believe in the cannabis industry's ability to bring well-being, health, and love into this world, and it is our mission to bring confidence to the cannabis shopping experience.To learn more about who we are, our engineering culture, and whether this is the right place for yo...
onsite Frontend (React), and Javascript full-time 314w ago
javascriptreactmachine-learning
Show description
Lumen5 | Frontend (React), and Javascript | Vancouver, BC | Fulltime, Onsite | https://lumen5.comWe're a startup (30 people so far) that is growing quickly! We're writing software that uses machine learning to automate the creative process of producing video content. We've found that what we're building is very attractive to marketing teams from lots of different organizations and we've got tons of interesting search, NLP, artificial intelligence, video rendering, and web scaling technical chall...
onsite Indianapolis, IN full-time 314w ago
javascriptphpreactgatsbylaravel
Show description
TrendyMinds | Indianapolis, IN | Onsite | https://trendyminds.comTrendyMinds is a creative, collaborative team of designers, developers, writers, and marketing specialists. We create videos, marketing experiences, and websites that connect audiences with brands they love. We have clients in just about every industry you can imagine, but we specialize in a few core verticals, including healthcare and life sciences.Tech we use:* HTML, CSS, JavaScript often using React or Gatsby* Craft CMS, Laravel...
onsite VP of Engineering full-time 314w ago
Show description
Elysium Health | VP of Engineering | New York, NY | Full-time | OnsiteOur mission is to turn critical scientific advancements into accessible consumer products. Working directly with the world’s leading scientists and clinicians, we translate research into solutions you can access today.Elysium Health is seeking a dynamic Vice President of Engineering to take a hands-on role in leading a lean team of world-class software engineers. Reporting directly to the CEO, you will be tasked with helping s...
onsite San Francisco, CA full-time 314w ago
stripe
Show description
Siteline | San Francisco, CA | Software Engineers | Fulltime onsite | https://jobs.lever.co/siteline(Note: We are early-stage company but our company health is safe and sound. We have always had a big long-term vision and the COVID-19 situation doesn't change that.)Getting paid on construction projects is slow and complex. In fact, the construction industry is the slowest in the country between finishing work and getting paid for it. Siteline is building a fast and foolproof experience enabling ...
onsite Full-Stack Engineer full-time 314w ago
reactvuenodejsawsdocker
Show description
Tellie | Full-Stack Engineer | San Diego / Los Angeles | ONSITE/REMOTE, FULL-TIME | https://tellie.tvTellie is a live & on-demand streaming platform that enables content creators to produce interactive content.Our vision is to create the future of interactive entertainment for audiences who want a deeper connection with the talent, community, and narrative of their favorite shows.We're building deceptively simple tools that deliver rich, satisfying interactive experiences. The platform is design...
onsite Engineering Positions full-time 314w ago
javascriptpythonreactdjangoflask
Show description
EDITED | Engineering Positions | London, UK | Onsite | Full-Time | VisaWe help retailers win. We are how the world’s best retailers get their products and pricing right. In order to accomplish this, we recruit the best and most diverse people to join EDITED.We’re currently hiring for Product Design, Front End, Back End and DevOps Engineers. Our stack is primarily Python & JavaScript, with frameworks like Django/Flask and React. We aren’t afraid to integrate new tech and like to keep exploring wh...
NY, NY full-time 314w ago
machine-learning
Show description
Dots | New York, NY | 2 eng positions: Backend Engineering Manager, Mobile Engineering (Unity) Manager | https://www.dots.co/jobs/Mobile Gaming Studio in New York City----------------At Dots, we are broad. Our games are beautifully executed from a graphic design, game design, and technological perspective. Our aim is to create experiences that do the little things extremely well. This results in a minimalist experience that has all the things you need and love, but none of the things you don’t. ...
remote Software Engineers full-time 314w ago
javascriptpythonreactnextjsflask
Show description
Nomad Health | Software Engineers | New York, NY and Charlotte, NC | Full-Time, REMOTE available* Help Nomad put clinicians on the front lines of the battle against COVID-19. *Nomad Health is changing the way nurses and doctors find work. We are eliminating the chaotic and inelegant healthcare staffing system of yesterday with a simple and modern digital platform. A team of builders and makers, our engineers are creative, highly-motivated problem solvers who want to improve the world of healthca...
remote 100% Remote full-time 314w ago
typescriptreactawskubernetesterraform
Show description
Gruntwork | 100% Remote | Full-time | Full-stack engineers, Frontend Engineers | https://gruntwork.ioGruntwork co-founder here. We aim to improve humanity's most important invention: Software. Our product enables software teams to launch and maintain production-grade cloud infrastructure in days, not months.We create the building blocks that devs and DevOps engineers can use to make launching in the cloud 10x better / faster / easier. We think of our work as creating a new paradigm for how DevOp...
remote Toronto full-time 314w ago
reactreact-nativerest
Show description
YKYZ | Toronto | Remote | Long-term contract | React & UIykyz.com is a small but fast growing (check our Alexa numbers) website that provides a forum for audio conversation and short form podcasting (microcasting). Our tech stack is React with a RESTful API. We use cryptographic signatures in place of a traditional login system, making our system partially decentralized.We are looking to fill at least two long-term contract positions right now.One is for an app developer with extensive experienc...
remote All Roles! Go / Golang full-time 314w ago
gokubernetes
Show description
strongDM | All Roles! Go / Golang | REMOTE (core hours ~US timezones, any latitude) | Full-time | https://www.strongdm.com strongDM is an identity-aware proxy for managing and auditing access to databases, k8s, and other servers. We build secure, high-throughput networking systems in Go.We're a fully remote (UTC -4 to -7), building software to help people work remotely. We have high standards and high levels of respect for each other and our customers.Current roles:* Senior Software Engineer (Go...
remote REMOTE/US full-time 314w ago
pythonjavareactdjangospringdockerkubernetes
Show description
Myriad Genetics | REMOTE/US | Frontend/Backend/Fullstack | https://myriad.com/working-at-myriad/joining-the-myriad-team...Myriad Genetics is a leading personalized medicine company dedicated to being a trusted advisor transforming patient lives worldwide with pioneering molecular diagnostics. Myriad discovers and commercializes molecular diagnostic tests that: determine the risk of developing disease, accurately diagnose disease, assess the risk of disease progression, and guide treatment decisi...
onsite Software Engineers, Artists, Designers full-time 314w ago
Show description
Singularity 6 | Software Engineers, Artists, Designers | Los Angeles, CA | Full-Time, OnsiteWe're hiring!Let's get a few details out up front:For the duration of the health crisis, we've transitioned into a fully remote, work-at-home environment. We can interview, hire and onboard you now. We're stable, with money in the bank and we're not going anywhere. We expect all new hires to onboard and work remotely until it's safe and reasonable to relocate to Los Angeles.Who are we?We're a VC funded (a...
remote San Francisco, CA and REMOTE full-time 314w ago
Show description
Twitter | San Francisco, CA and REMOTE | Frontend/backend/fullstack, data science, and engineering managementWe're starting a new team to build a new capacity management system for our infrastructure platform. This iteration has a stronger product focus on enabling engineers while supporting partners in finance and supply.We need to build internal tooling to predict demand, track supply, prioritize allocations, and report on utilization across a large fleet of physical servers (>100k) and an exp...
remote full-time 314w ago
Show description
Odoo: Open Source Business Apps https://Odoo.com
We recruit developers in Belgium and business advisors (US, Belgium, Hong Kong). We have a full remote process for the interview, in less than 5 days.Https://odoo.com/jobs
Embedded Developer with C/Python full-time 314w ago
python
Show description
Trusted Science and Technology | Embedded Developer with C/Python | seL4 developer | Full Time | Flexible hours | Rockville, MDTrusted Science and Technology is a small research and development company. We create innovative cyber security solutions for DARPA, AFRL, and other DoD/IC research agencies.We are looking for developers that are low level embedded and have experience with seL4 or other separation kernels.contact@trustedst.com
onsite Software Engineer full-time 314w ago
scalaoracledockerkubernetes
Show description
Oracle | Software Engineer | SF, CA | ONSITE | Full TimeThe Oracle Cloud Infrastructure, Registry team is looking for a senior Scala software engineer. Our service is architected as an Event-Sourced, Distributed system built on CQRS principles. Our technology stack is Scala / Akka / Play. If you have ever wondered what it is like to apply Functional Programming principles in a live, production environment this is the role for you.The Registry service is a managed, multi-tenant registry for Docke...
onsite DevOps, Full Stack, SDET full-time 314w ago
angularnodejsmysqlrediselasticsearchblockchainkafka
Show description
Paystand | DevOps, Full Stack, SDET | Scotts Valley CA, US. Guadalajara, Mexico | ONSITEAt Paystand, we are building the next generation B2B payment network. We have been described as "like Venmo but for B2B payments". We believe that the current payment infrastructure which was built more than 50 years ago is obsolete, and full of "intermediaries" each of which is taking a cut on each payment. We also believe that making a payment is just "moving bits and bytes" similar to what you do to send a...
remote Remote full-time 314w ago
linux
Show description
Analytics fire | Remote | Full-time | Senior Embedded Linux Developer with C/C++ -- 100% Remote, Flexible hours
https://www.linkedin.com/jobs/view/1787277799?trk=cap_redire...Analytics Fire builds custom software for the solar power industry. We’re looking for a senior embedded developer with deep experience developing, testing, and debugging embedded software in a Linux environment to help us expand our services to support manufacturers in clean energy and other high-tech sectors.Analytics Fire...
remote Backend / iOS / Android / Data Science / Testing full-time 314w ago
awsiosandroid
Show description
Life360 | Backend / iOS / Android / Data Science / Testing | San Francisco & San Diego, CA & REMOTE25 million monthly active users.Doubled userbase year-over-year.Public company with real revenue.Bringing peace of mind to families with technology.We're hiring engineers for our back-end Cloud Engineering and Mobile teams to help us scale up globally. Our tech stack in total handles over 5 billion API requests daily, so if you know your way around AWS microservices and love writing efficient fault...
remote SRE full-time 314w ago
javascriptpythonnodejsmongodbrediselasticsearchawsterraform +1
Show description
Trello | SRE | NYC / Remote | Full-time | https://www.atlassian.com/company/careers/detail/6e2f6f54-03...As a Site Reliability Engineer at Trello, you’ll work on keeping everything running efficiently as we scale our infrastructure from supporting over 35 million Trello users today towards our goal of 100 million users and maintaining our target of 99.99% uptime.Our engineers and designers run the show with management existing to support, not dictate. We hire creative people and give them the au...
remote https://skysight.io full-time 314w ago
javascriptreact
Show description
SkySight | https://skysight.io | REMOTE | Part-time/Contract | React developerSmall company based in Aus, myself and a few contractors, looking for React JS/Native skills for a frontend rewrite project. Should have an eye for good design/UX.WebGL/GIS/charting/infovis/aviation/weather skills a bonus.email to: matthew (at) skysight.io
remote Chicago, IL full-time 314w ago
Show description
Printavo | Chicago, IL | Full-time | Remote | https://www.printavo.comI started Printavo from running a screen printing business in college. We needed simple, software to keep track of our orders as they came in. The solutions that were available were complicated and expensive. I built Printavo to fix this.Today, we're bootstrapped, profitable and a team of 13 in downtown Chicago. We're looking for an another Software Engineer to join and help us continue to grow.Please email bruce@printavo.com ...
onsite full-time 314w ago
Show description
Posting for two companies in Schematic portfolio.Torch : Short haul Freight Platform : Full-Time CTO in ChicagoStealth : E-commerce Returns Platform : Full-Time CTO in AustinBoth companies funded in the past quarter. Capitalized well into next year. Must be onsite (not remote).julian@schematicventures.com
onsite Frontend Engineer, Tooling Engineer, Full Stack Engineer (Junior, Mid and Senior) full-time 314w ago
Show description
Stile Education (https://stileeducation.com/) | Frontend Engineer, Tooling Engineer, Full Stack Engineer (Junior, Mid and Senior) | Melbourne, Australia | Full-time | Onsite (flexible WFH, remote for the next 6-12 months)We're a small, diverse, tight-knit team with a mission to radically improve main-stream science education at schools. By creating world-class science lessons, coupled with intuitive tools that allow teachers to take advantage of the latest pedagogies, we’ve already helped severa...
USD 135k/yr remote Full-Stack, PHP, Java, C++, iOS, Android, and/or Infrastructure Engineer full-time 314w ago
javaphpsqliteiosandroidblockchain
Show description
Expensify | Full-Stack, PHP, Java, C++, iOS, Android, and/or Infrastructure Engineer | San Francisco, Portland, Michigan, London | REMOTE, VISA welcome | Full-time | we.are.expensify.com | $135K+Expensify is the most widely used expense management system in the world, with millions of users and more customers than the rest of the industry combined, processing billions of real dollars annually. Expensify has ~130 employees, is self-managed (no VC control), is extremely profitable, and is working ...
remote https://localizejs.com full-time 314w ago
javascriptnodejsexpressmongodbredisawscirclecimocha +1
Show description
Localize | https://localizejs.com | REMOTE | Full-time | Full Stack Javascript DeveloperLocalize is a platform used by 500+ companies to translate websites and applications into other languages. We're used by companies like Trello to translate their help center (https://help.trello.com/), Tinder to translate their blog (https://blog.gotinder.com/), and RocketMiles to translate their web app (https://www.rocketmiles.com/) - to see our product in action, click any of those links and use the websit...
onsite Frontend/Fullstack Engineer full-time 314w ago
segment
Show description
Loop54 | Frontend/Fullstack Engineer | Stockholm, Sweden | ONSITELoop54 is a search/relevance engine as-a-service, marketed primarily toward the small–medium–large segment of the e-commerce market. We can probably achieve the most relevant results in the world for our client base right now, through what's fundamentally pretty basic AI techniques[1]. We have the ability to tailor result pages specifically to individual users.What is currently one of the bottlenecks is that we have no useful feedb...
onsite Minneapolis, MN full-time 314w ago
Show description
Perk Motivation (https://perkmotivation.com) | Minneapolis, MN | Full-time | Onsite & Remote | Software Engineer, Product ManagerInstead of wondering what's wrong with healthcare, Perk Motivation is working with our clients to get it right. Not your average dev shop or consultancy, we specialize in long-term engagements where we build deep working relationships with our clients in pursuit of some of the most pressing questions in healthcare like "how do we best taper down opioid prescriptions?" ...
remote REMOTE (GMT-1 to GMT+3 only) full-time 314w ago
azure
Show description
M-KOPA Solar (http://www.m-kopa.com/) | REMOTE (GMT-1 to GMT+3 only) | Azure / .NETM-KOPA Solar provides solar energy systems for lighting and television to customers in emerging markets. Our systems are sold on credit and customers' loan payments are enforced via embedded software running that enable/disable the systems based on payments. Once a customer has finished paying for their system they own it outright and remote controls are disabled.We currently have a customer base of over 700,000 h...
Mobile, Backend, Web, Distributed Systems full-time 314w ago
iosandroid
Show description
Duolingo | Mobile, Backend, Web, Distributed Systems | Pittsburgh, New York City, BellevueWe are still hiring! For folks who are finishing school, go here: https://university.duolingo.com/We're changing how people around the world learn new languages. We're a multilingual, diverse group of people who work in small, cross-functional teams to help change the world, one word at a time. We're learners first, and we specialize in making learning fun.We have several roles open - check out all of them ...
onsite Senior Technical/Physical Security Systems Administrator full-time 314w ago
Show description
Tesla | Senior Technical/Physical Security Systems Administrator | Berlin, Germany | ONSITE | https://www.tesla.com/careers/job/sr-securitysystemsadminist...The Technical Security team is responsible for implementing technology solutions to improve the physical security of Tesla's people, places and intellectual property. We're growing our internal team to evolve our physical security infrastructure and invent new ways to solve some very old questions; this role will be central to the success of...
remote software / signal processing / data / analysis / QA / project mgmg / product management full-time 314w ago
Show description
Evidation Health | software / signal processing / data / analysis / QA / project mgmg / product management | Santa Barbara, Bay Area, and REMOTE | Full-timeEvidation Health runs distributed virtual health care studies in partnership with research, government, non-profit, and for-profit organizations. We're a mission driven company aiming to use technology to improve health-outcomes for everyone. Evidation has existed for 7+ years, but I think uniquely in our current moment it's very obvious the ...
onsite Senior/Staff Software Engineer full-time 314w ago
Show description
Thumbtack.com | Senior/Staff Software Engineer | San Francisco | Full-time | Onsite (flexible)Have you ever tried to hire a plumber? How about a house cleaner? If you have, chances are it took you way longer than it should. In the era of instant-everything, it’s crazy that you still have to waste an entire afternoon researching, calling and vetting local service professionals whenever you need one. The market for hiring them is huge — $1 trillion in the US alone — but the process is inefficient ...
onsite Frankfurt, Germany full-time 314w ago
typescriptkotlinangularspringawsgcpazurekubernetes +3
Show description
meshcloud | Frankfurt, Germany | Onsite & Remote | https://meshcloud.iomeshcloud helps some of the largest enterprises in the world manage thousands of AWS Accounts, Azure Subscriptions and GCP Projects using our multi-cloud management platform. We automate IAM, administrative processes & security policies so that DevOps Teams can enjoy private & public clouds without obstructions.Our open positions and tech stacks:* Fullstack Engineers: any of Kotlin, Spring, Angular, TypeScript, RavenDB* Front...
onsite Data Scientists/Engineers across the stack full-time 314w ago
machine-learning
Show description
Kensho Technologies | Data Scientists/Engineers across the stack | Full-time/Onsite | (Cambridge/Boston)/NYC/DC/LA
At Kensho, we leverage S&P Global’s world class data to research, develop and implement leading AI and machine learning capabilities that drive fact-based, objective decision making. From deep learning speech recognition and transcription to advanced visualizations, entity recognition, state-of-the-art search and an AI-driven research platform, the Kensho team brings actionable insi...
onsite Berlin, Germany full-time 314w ago
javascriptpythonpostgresqlmachine-learning
Show description
Lateral | Berlin, Germany | Onsite (currently temporarily remote) | Full-time | https://lateral.io/Lateral, a machine learning startup, is looking for a front-end developer and a junior back-end developer to join our growing team. We are creating production systems around cutting edge machine learning and deploying them to help a wide range of industries, be it building physical infrastructure or drafting proposals, to optimise existing workflows. We are passionate about UX and design and strive...
remote Louisville KY full-time 314w ago
c#aspnetazure
Show description
SEEKING FREELANCER | Louisville KY | 100% Remote
Fern Creek is a software consulting company. We build stuff for other people, usually in .NET on Azure but we do other stuff occasionally. The company has been around since I started consulting independently about 20 years ago. Recently I started taking on larger projects that need more people.Right now I have immediate need for a QA engineer. This role is a 10 week contract to write unit tests and integration tests in C# against an asp.net core s...
onsite Software Developer - DevOps Team, QE Specialist(onsite only) full-time 314w ago
gojavaclojurereactpostgresqlelasticsearchawsdocker +7
Show description
Kira Systems | Software Developer - DevOps Team, QE Specialist(onsite only) | Toronto, Canada | Remote | Onsite | https://www.kirasystems.com
Kira Systems is a powerful machine learning software that identifies, extracts, and analyzes text in your contracts and other documents. Our software is intuitive and easy-to-use to uncover relevant information for some of the largest law firms, professional services and corporate companies in the world.We're hiring a Software Developer (DevOps) to work cl...
hybrid Lisbon (Portugal), San Francisco and Seattle full-time 314w ago
kubernetes
Show description
MemSQL (https://memsql.com) | Lisbon (Portugal), San Francisco and Seattle | Full TimeMemSQL is a database startup focused on high performance, hybrid workloads. Our customers include half of the top 10 US banks, 2 of the top 3 US telcos, and 12% of the fortune 100. You can read all about our product here: https://memsql.com/product.Right now, we are in the process of building a next generation data platform capable of handling many different workloads in one system. Think about a massive compan...
onsite https://ought.org full-time 314w ago
machine-learning
Show description
Ought | https://ought.org | Software Engineer | San Francisco (onsite)We're a non-profit AI research lab. Our goal is to make machine learning solve tasks where success can’t be reduced to a simple metric. We're working towards a future where ML is as helpful for open-ended questions like “Should I get this medical procedure?” and “What career is right for me” as it is for optimizing ad click-through rates.To do this, we build systems that decompose thinking about hard questions into small subta...
onsite Senior Frontend Engineer, Senior UX Designer full-time 314w ago
javascriptreactmysqlkubernetesgraphqlgrpc
Show description
Chronosphere | Senior Frontend Engineer, Senior UX Designer | NYC, Seattle | Full-time Onsite (Remote for now) | VISAChronosphere is a Series A startup delivering the most highly scalable and reliable open source metric data platform to the world. That platform is M3, which was created by the founders of Chronosphere while at Uber. It is the only open source metric data platform proven at petabyte scale in production, stores over tens of billions of metric time series and ingests and serves bill...
onsite San Francisco full-time 314w ago
Show description
BitMEX | San Francisco | VISA | On-Site | bitmex.com/careersWhat is BitMEX - and why do we exist?BitMEX is a derivatives trading platform that offers investors opportunities using only Bitcoin. We are not a spot exchange where you can buy Bitcoin with USD or other fiat currencies.
Across the globe, and particularly in Asia, we have over half a million open accounts, of which approximately 100,000 belong to active users.
Effectively, BitMEX offers commercial hedgers, Bitcoin miners, and professio...
remote full-time 314w ago
Show description
REMOTEWorkReduce is an American company that handles back-office and middle-office operations for advertising agencies. We have been 100% remote for years. I've been with the company since we were seed stage and we're growing quickly.We are hiring 10 full-time employees (with benefits) for SEM roles. The company has been 100% remote since day one.We are hiring for both _Associate_ and _Supervisor_ roles.Associate skills: Analytical Skills, Advertising, Digital Marketing, Search Engines, Advertis...
onsite Senior Data Engineer full-time 314w ago
Show description
Mira (https://mirabeauty.com) | Senior Data Engineer | San Francisco | Full-time | Onsite (flexible)Mira is a fast-growing social marketplace attacking the $500B global beauty industry. Powered by the industry's largest comprehensive beauty content dataset, Mira uses AI and computer vision to fundamentally improve the customer's journey from product discovery through purchase.For the vast majority of beauty shoppers, finding the right cosmetics products is time-consuming and difficult. Although ...
onsite San Francisco, CA full-time 314w ago
pythonkubernetesmachine-learning
Show description
SentiLink (https://sentilink.com) | San Francisco, CA | On-Site | Data ScientistSentiLink prevents synthetic fraud, an emerging fraud vector in which fraudsters open accounts using name/DOB/SSN combinations that don't correspond to real people. Our partners include top ten US banks, fintechs, and alternative lenders. We're backed by investors including a16z, Max Levchin (Affirm CEO/PayPal cofounder), and former presidents/CEO's of Visa, Transunion, HSBC, and Citi.Our tech stack uses Go (for the ...
Los Angeles, CA full-time 314w ago
kotlinreactrailspostgresqlredisandroid
Show description
CareRev | Los Angeles, CA | Data, Product, Web, Back-end/API, Android, ToolsWe provide software to Hospitals, Clinics, and Surgery Centers to fill more RN, CNA, Tech, and MA shifts where needed with staff and/or external workforce.We are super busy on account of the novel coronavirus, so this is brief. Help us get healthcare professionals to the right place at the right time to provide the best care possible.Tech Stacks:
Android - Kotlin;
Web - Elm w/ Legacy React;
API - Rails/Postgresql/Redis;
...
remote Technical marketeer full-time 314w ago
machine-learning
Show description
Edge Impulse (https://edgeimpulse.com) | Technical marketeer | REMOTE (North America or Europe)Edge Impulse enables developers to build the next generation of intelligent devices with embedded machine learning (also known as TinyML). We believe that our platform will unlock immense value from 99% of edge devices data that is currently being discarded due to cost, bandwidth or power constraints. Our SaaS platform provides new ways for data ingestion, labeling, training, and deployment capabilitie...
onsite Bellevue (Seattle) full-time 314w ago
machine-learning
Show description
Gaia Platform (https://www.gaiaplatform.io) | Bellevue (Seattle) | Full-time | Onsite Strongly PreferredGaia is creating a platform to enable autonomous machines. We are building a new architectural model that is centered around data, in-memory databases, data-based programming models, robotics, machine learning, and new programming languages and paradigms. We are looking for engineers at all levels with experience in ML, robotics, database implementation, expert systems, rules engines, and prog...
USD 2k-3k/yr remote Remote Android Engineer full-time 314w ago
javaiosandroid
Show description
NewsBlur (YC S12) | Remote Android Engineer | Remote | Part TimeI'm looking for an Android developer to help build the next version of the NewsBlur Android app. NewsBlur is a popular RSS news reader with apps on the web, iOS, and Android as well as a thriving third-party developer scene and integration into over a dozen news readers.Are you or somebody you know looking for a part time Android development gig that gives you schedule and feature autonomy? The next version of the NewsBlur Android a...
Backend, Systems, Machine Learning, Full Stack, DevOps full-time 314w ago
javascriptpythonreactnodejsrediscassandradockerkubernetes +2
Show description
Nightfall AI | Backend, Systems, Machine Learning, Full Stack, DevOps | San Francisco, CA or Lehi, UT | https://nightfall.aiNightfall is a data security startup dedicated to helping enterprises discover, classify, and protect sensitive data across their cloud footprint - their corporate SaaS, data infrastructure, and APIs - via machine learning.- We’re looking for folks passionate about working at the intersection of deep learning, information security, and distributed systems.- Tech Stack: Go, ...
onsite Privacy, Backend, Data Engineering, Front End, SDET, Analytics full-time 314w ago
Show description
BlueOwl LLC | Privacy, Backend, Data Engineering, Front End, SDET, Analytics | San Francisco, CA or Portland, OR | ONSITE hiring distributed during the pandemic.We’re here to create a safer, happier and more mindful future for all with the help of data science, engineering, design, and mobile technology. We're starting by reinventing insurance, by rethinking the technologies that enable it, but our true goal is to build a platform that rewards people for driving well — creating safer roads with ...
onsite WA, DC full-time 314w ago
Show description
Presidential Innovation Fellows | Washington, DC | ONSITE | Full-timeThe Presidential Innovation Fellows (PIF) program is looking for high-performing data scientists, designers, engineers, executives, innovators, product managers, and technology strategists that care deeply about solving our nation’s most difficult challenges and want to deliver better products, services, and experiences to the American public.The program is a highly selective, non-partisan, innovation fellowship that pairs tale...
remote Software Engineer, Product Manager, Designer full-time 314w ago
typescriptreactpostgresqldockerkubernetesgraphql
Show description
Sourcegraph (https://sourcegraph.com) | Software Engineer, Product Manager, Designer | ALL REMOTESourcegraph makes code search universal so developers can focus on solving problems instead of struggling to find and understand code. Read our master plan to learn more about what we’re building, and why it matters: https://sourcegraph.com/planWith Sourcegraph, you can instantly search across both your company’s private code and public open-source code with inline code intelligence providing go-to-d...
full-time 314w ago
pythonkubernetesmachine-learning
Show description
At Tesorio we are looking for a Data Engineer with K8s expertise - https://jobs.lever.co/tesorio/f77eaea4-4ff6-4718-b125-723513...We’re now looking for a Data Engineer or Senior Backend Software Engineer who can lead the charge in developing and maintaining the platform that will support large-scale ML deployments. This project you are joining is fast-paced and for a large bank, so you must be experienced—you will not have time to simultaneously onboard, gather business context, and deliver on t...
onsite Machine Learning Engineers and Scientists (Data Science Team), Backend Engineers (Applications Team) full-time 314w ago
machine-learning
Show description
Kaiser Permanente Medical Informatics | Machine Learning Engineers and Scientists (Data Science Team), Backend Engineers (Applications Team) | San Diego, CA | ONSITE after the virus subsidesMedical Informatics team develops clinical decision support, auditing, and virtual care solutions for Kaiser Permanente (KP). Our unique operational position within KP gives us complete access to KP's massive EHR and a broad mandate to develop machine learning models and applications for all aspects of clinic...
onsite San Francisco, CA or NY, NY full-time 314w ago
javascriptreactnodejspostgresqlawsterraformansible
Show description
Nova Credit (YC W12) | San Francisco, CA or New York, NY | Onsite | https://www.novacredit.comDespite having built substantial credit in their home countries, millions of immigrants have difficulty accessing credit cards, loans, mortgages, and leases without domestic credit. Nova Credit enables newcomers to share their credit history from their home country with financial service providers and others, unlocking new consumers for lenders, and new futures for immigrants. We are ~50 people and have...
Designer, Full-Stack Engineer/Developer full-time 314w ago
figmastripe
Show description
Wanderlog (YC W19) | Designer, Full-Stack Engineer/Developer | San Francisco | https://wanderlog.com/, https://wanderlog.com/blog/jobsWanderlog is building tools to make leisure travel easier. We're a YC W19 graduate who's raised a seed round and looking to hire our second (non-founder) engineer. We've raised $1.5m, but aim to only hire one more engineer to keep our burn low.We believe that travel makes us and the world better, and are trying to lower the bar to travel by bringing together all t...
remote Frontend engineers, product roles full-time 314w ago
reactnodejsgraphql
Show description
Dutchie | Frontend engineers, product roles | REMOTE USA or Bend, ORDutchie is the cannabis industry’s leading and fastest-growing e-commerce provider, powering online ordering for the top dispensaries throughout the United States. We are a product-focused company that has created a best-in-class experience for cannabis dispensaries and shoppers.Since our inception in 2017, we have experienced significant growth. We are backed by Gron Ventures, Snoop Dogg’s Casa Verde Capital, one of the leading...
remote Zurich full-time 314w ago
Show description
ETH Zurich | Zurich | Scientific Software Engineer | REMOTE VISA | Full TimeWe are looking for an experienced scientific software engineer to manage a large portfolio of software projects related to research in AI/robotics.https://www.jobs.ethz.ch/job/view/JOPG_ethz_0bLTBTpoEGw80iJU...
remote Backend Python Web Developer full-time 314w ago
pythondjangoflaskrest
Show description
Zipari | Backend Python Web Developer | New York City, NYC, Brooklyn | Full Time | Remote USA | https://jobs.lever.co/zipariZipari is the premier technology platform for health insurers. We're growing fast and need talented back-end Python engineers with a firm grasp of how the web works.You'll be:-Designing and developing cloud based software products conforming to industry best practices.-Designing and implementing RESTful APIs using Python.-Supporting and maintaining existing software product...
onsite San Francisco full-time 314w ago
Show description
Lob | San Francisco | Sr Software Engineer | Onsite or Remote (CA,TX,PA,MI,IL,NY)Hi - founder of Lob (YC S13) here. We're looking for software engineers who would like to join our New Product Development team that is responsible for building the next gen of our offline data API products.Info here: https://lob.com/careers/1895237If you think you're a good fit, feel free to shoot me a note directly too (harry [at] lob [dot] com)
onsite San Francisco full-time 314w ago
Show description
Electronic Frontier Foundation | San Francisco | Director of Technology Projects | ONSITE | Full TimeEFF is seeking a Director of Technology Projects to help lead our team of ethical technologists in defending encryption, outwitting censorship, and coding a better digital future. This is a senior leadership role within EFF, and will help guide the organization in charting its overall external technical strategy.more at:https://www.eff.org/opportunities/jobs/director-technology-p...
remote REMOTE (PT-ET Timezones) full-time 314w ago
pythonreactflaskaws
Show description
Postscript.io (YC W19) | REMOTE (PT-ET Timezones) | Full-time Engineers (Full Stack)Postscript is a fully remote team of 20 looking for help in solving complex problems like real-time streaming data (1000's of events per second) on the back end and beautiful, simple ways of interacting with that data on the front end. We help ecommerce companies stay in touch with their customers (marketing, customer service, order management, and other notifications via text messaging).We're scrappy hackers sea...
onsite Vienna, Austria full-time 314w ago
Show description
Prescreen | Vienna, Austria | DevOps/BE/QA Engineers & Product Managers | ONSITE | Full TimePrescreen is one of Europe’s fastest growing HR tech startups. We are a small but highly effective team delivering value to our users fast and in high quality. Working here still feels like in a startup but we do have some of the benefits of being a post-exit company (financial stability, 30 days of yearly paid vacation, all kinds of benefits...)All our positions are listed on our homepage: https://prescr...
Product Security Engineer full-time 314w ago
Show description
HelloSign, a Dropbox company | Product Security Engineer | San Francisco | Full TimeHelloSign builds e-signature platforms to help businesses execute important agreements on the web, interface with legacy systems via fax, and collaborate more effectively.We're looking for product security engineers to help our SWEs develop new features securely, and also help write new security features ourselves to keep our customers safe by default. We have a lot of interesting problems to solve and a small, f...
onsite San Francisco or Nairobi full-time 314w ago
Show description
Angaza | San Francisco or Nairobi | ONSITE | https://www.angaza.com/careers/Angaza makes it possible for life-changing products, such as solar + battery home energy systems, to be sold _on payment plans_ in off-grid regions across Africa and Asia.We've reached millions of people whose homes now have electricity for the first time:- https://youtu.be/2EvEeAs_9R4 and https://youtu.be/onMT6_Yv67I- https://www.angaza.com/category/engineering/The technology you build will reach more than a billion mor...
onsite Site Reliability Engineer (SRE / Infrastructure Engineer) full-time 314w ago
pythonterraform
Show description
Ubisoft Massive | Site Reliability Engineer (SRE / Infrastructure Engineer) | Malmo, SE | Onsite, Relocation/VISA offered | http://www.massive.seMy team is looking for an automation focused individual to help us release AAA games with the highest possible reliability, while supporting the needs of the adjacent programming squad. Our team is comprised of classically trained sysadmins who have always had a brush with automation, we work very closely with C++ programmers so experience or willingnes...
remote CTO, Frontend Engineer, Backend Engineer full-time 314w ago
javascriptrubyvuerailsionic
Show description
GreenStork (https://greenstork.com) | CTO, Frontend Engineer, Backend Engineer | LA, CA and REMOTE | Part-timeGreenStork makes it easy for cannabis dispensaries to accept online orders from their own website or from our marketplace. You can see a 1 min. explainer video here. https://vimeo.com/238992565I'm currently a solo founder and GreenStork is bootstrapped and fully built. I'm looking to bring on a CTO and engineers for equity / possibly as co-founders. These would be part-time, remote posit...
onsite https://rollbar.com full-time 314w ago
herokutwilio
Show description
Rollbar | https://rollbar.com | San Francisco, Barcelona, Budapest ONSITE or REMOTE | Tech Lead, Senior Software Engineer, Customer Success, MarketingAbout Rollbar:* We help tens of thousands of developers find and fix errors faster.* Our backend handles billions of errors with low latency and high reliability* Our front-end allows developers to discover and drill down across millions of errors in real-time* Our open source libraries are used by some of the best engineering teams in the world, i...
remote Full Stack Engineer full-time 314w ago
Show description
Cortico | Full Stack Engineer | Remote (Boston HQ) | Full-time | https://cortico.aiCortico is a non-profit tech organization spun out of the MIT Media Lab. We're building hardware and software to amplify under-heard voices in our communities and in the media to improve our understanding of one another. More specifics on the project at https://lvn.org. Come help scale deep listening with our experienced crew of technologists and humanists.Questions welcome at dvd[at]cortico.ai.https://jobs.lever....
onsite NY, NY full-time 314w ago
javascript
Show description
Insider, Inc (Business Insider) Software Engineer, Test Engineer, SecOps Engineer, Javascript Engineer | New York, NY | Onsite | Full TimeInsider Inc. is the publisher of INSIDER, Markets Insider, and 17 international editions of Business Insider, including the flagship NY-based US edition. The company pioneered a digital-native approach to news and information that is social and mobile at its core, for an ambitious and curious global audience that grew up with digital. The company launched in 2...
onsite Senior Fullstack, Senior Backend, Payments, Engineering Managers full-time 314w ago
javascriptreact
Show description
Faithlife | Senior Fullstack, Senior Backend, Payments, Engineering Managers | Bellingham, WA or Chandler, AZ | Fulltime | Onsite or Remote Faithlife is a tech company committed to the church. We build the world’s premier Bible study software (Logos Bible Software), along with an entire line of resources for Christian living: Faithlife.com (an online church management and communication platform), Proclaim (a cloud-based church presentation tool), Faithlife TV (video streaming service), the Faith...
full-time 314w ago
Show description
Attio based in UK London; Full time; Product and Engineering
https://attio.com/join-us
onsite London (UK) full-time 314w ago
javascriptpythondjangopostgresqlgcppytorchmachine-learning
Show description
Element Human | London (UK) | Full-time, Onsite initially with remote progression (in the office for a few days every quarter for example).100% remote for the foreseeable future, probably until the end of summer.We're using machine learning to read human behaviour; we use eye-tracking to track attention, facial coding to understand engagement, and implicit testing to quantify memorability. We've just launched a new platform and we're looking for more engineers so we can expand our offering. Our ...
onsite Various Engineering, Design, and Product Roles full-time 314w ago
javascriptrubyreactrailspostgresql
Show description
Relevant Healthcare Technologies | Various Engineering, Design, and Product Roles | Full-time, Onsite | New York City | https://relevant.healthcare/#jobsRelevant builds workflow and analytics tools for healthcare non-profits that provide care to the underserved in the US. We're a bootstrapped and mission-driven company filled with passionate and lovely humans who are lucky to get to work on interesting problems for unimpeachably good actors in the healthcare space. Come join us!Our tech stack is...
onsite Redwood City, CA full-time 314w ago
php
Show description
EPIC! | Redwood City, CA | Full Time | Onsite (Remote during shelter in place) https://www.getepic.com/careersEpic gives millions of families and classrooms instant, unlimited access to thousands of books, videos and quizzes from leading publishers to help kids everywhere read, learn and grow. We are having our moment as we reach more users through our online learning platform available to kids everywhere during this difficult timeActively hiring: Senior PHP Backend Engineer,
Social Media Manage...
onsite Various engineering openings full-time 314w ago
Show description
Vena Solutions | Various engineering openings | Full-time, Onsite | Toronto, Canada | https://careers.venasolutions.com/job-board/#Vena is a Toronto-based rapidly growing startup with 300+ employees. We build Financial Planning and Analysis (FP&A) software that's based on an Excel plugin.Looking for developers of all seniority levels to help build new features as well as solve back-end and front-end challenges as we scale the solution to more customers and more data.
remote Computer Vision / Machine Learning Engineer full-time 314w ago
machine-learning
Show description
Osmo | Computer Vision / Machine Learning Engineer | Palo Alto, CA or REMOTE USA| Full-time | www.playosmo.comWe are at the intersection of digital and physical play and learning. We make educational toys and games for kids. It's a little hard to explain, so I'll let our website do the explaining (www.playosmo.com).This is a great opportunity for working in a small (5 right now), driven team and come up with creative solutions for CV tasks. We work closely with industrial designers and game deve...
onsite Software Engineer full-time 314w ago
Show description
Secureframe | Software Engineer | San Francisco, CA | Full-time | OnsiteSecureframe is on a mission to help companies secure themselves and their customers. We are building software to address problems that affect nearly every modern business, like achieving SOC 2 compliance fast, and for a fraction of the cost.The full job description is available here: https://angel.co/company/secureframe/jobs/750671-software-en...
onsite Hoboken, NJ and Dublin, Ireland full-time 314w ago
machine-learning
Show description
Flow Commerce | Hoboken, NJ and Dublin, Ireland | Senior Backend / Senior Frontend / Senior Machine Learning/ Senior Product Designer / Senior Product Manager / Solutions Engineer | flow.io/careers / Full-time Onsite (remote until things normalize)Flow is a SaaS e-commerce platform that enables brands and retailers to become international and sell cross-border. Flow’s API driven platform enables merchants to sell & ship globally from their own sites, solving all cross-border pain points througho...
onsite Various Engineering Openings full-time 314w ago
javascriptpythonreactnodejspostgresqlawsgcpspark +1
Show description
Uplight | Various Engineering Openings | Full-time, Onsite | Boulder, Denver, Vancouver, Boston, Pune | https://uplight.com/careers/We're looking for engineers who want to fight climate change. We motivate energy users and providers to accelerate the clean energy ecosystem. Working with more than 80 of the world's leading electric and gas utilities, we provide an end-to-end customer energy experience that helps meet and accelerate carbon reduction goals.Our tech stack includes: Python 3, JavaScr...
remote REMOTE or BOSTON, MA full-time 314w ago
Show description
Abine - the online privacy company | REMOTE or BOSTON, MA | PART Time or Full Time | Web application and Full Stack Developers | https://www.abine.com/ | https://joindeleteme.com/We are a small company focused on making better online privacy easy.We make two products. Blur is a password manager with support for creating alias email addresses, phone numbers, and credit card numbers. DeleteMe is a service for removing private information from data broker sites.We're looking for strong web applicat...
onsite Product Engineer + Product Designer full-time 314w ago
Show description
evervault | Product Engineer + Product Designer | Dublin, Ireland or San Francisco, CA | ONSITE | €60k - €90k + meaningful equity stake
https://evervault.com/Passionate about data privacy? Looking for something different in these crazy times?Backed by Sequoia, Kleiner Perkins, SV Angel and other leading investors, at evervault we're building the internet infrastructure for data privacy.Privacy is no longer something that compliance teams look after alone — it's becoming a core component of your ...
onsite Lead Data Analyst full-time 314w ago
Show description
Updater | Lead Data Analyst | Oakland, CA or New York, NY | Onsite | https://www.updater.com/Updater makes moving easier for the 17 million households that relocate every year in the US.Job posting with more details: https://boards.greenhouse.io/updater/jobs/1845916?gh_src=88f...
remote RUBY ON RAILS full-time 314w ago
rubyrails
Show description
PEXELS.COM | RUBY ON RAILS | REMOTEPexels is one of the 1k most visited websites in the world (https://www.alexa.com/siteinfo/pexels.com#card_rank). We're a platform to find free stock photos and videos. We're a small team looking for a (backend) Ruby on Rails developer to help us grow even bigger. Apply here: https://angel.co/company/pexels/jobs/406774-remote-backend-r...
Software Engineer full-time 314w ago
javascripttypescriptrubyelixir
Show description
Tinfoil Security (Synopsys Software Integrity Group) | Software Engineer | San Francisco, CA / Mountain View, CA | Full-timeWe're hiring for the Tinfoil Security engineering team at Synopsys! We're looking for engineers at all skill levels to continue developing Tinfoil's Webapp and API security tools. We have a close-knit team and a diverse tech stack (Elixir, Ruby, Javascript/Typescript, Go).https://tinfoil.co/go/job_SWE2
https://tinfoil.co/go/job_SWEsr2
remote Full Stack Developer full-time 314w ago
aws
Show description
Amazon Web Services - Jam Platform | Full Stack Developer | US, REMOTE | Full-timeWe are a small team that builds the AWS Jam platform (https://jam.awsevents.com), a gamified learning experience using hands on labs and CTF style events.https://www.amazon.jobs/en/jobs/890118/full-stack-developer
onsite South San Francisco, CA full-time 314w ago
machine-learning
Show description
Freenome | South San Francisco, CA | Onsite / flexible | https://www.freenome.com/careersWe're using ML to develop a blood-based screening test for colorectal cancer, the second-most-deadly cancer (after lung). Over 50,000 people die every year in the US from this, because they don't find out they have it until too late.https://techcrunch.com/2019/07/24/with-160-million-in-new-fu...
https://bmccancer.biomedcentral.com/articles/10.1186/s12885-...Unlike drugs, diagnostics require only a single lar...
remote Los Angeles, CA REMOTE OR LOCAL full-time 314w ago
Show description
Private | Los Angeles, CA REMOTE OR LOCAL | Ecommerce Full StackWe're a cannabis manufacturing and distribution firm that's been in business since 2013. Company is privately held with myself as the sole shareholder. We manufacture and distribute cannabis goods to retailers. We have an enormous opportunity right now to open a direct-to-consumer delivery service. We have all the licensing in place and have experience manufacturing every category of cannabis product (gummies, chocolates, vapes, tab...
full-time 314w ago
rusthaskell
Show description
Onai | | San Jose or New York | FULL TIME, CONTRACTORS, GRADUATE INTERNS, POSTDOCTORAL FELLOWS, VISAWe're tackling exciting difficult challenges and building offerings relevant to interesting real-world problems in a variety of fields. We have particular strengths in dispersed computation, functional programming, protocol design, and deep learning.We're currently most interested in engineers with solid experience in Rust, Haskell/Idris, or cryptography. We also have openings for enthusiastic dev...
onsite UI, Data-Viz, Backend, Data Infra full-time 314w ago
machine-learningspark
Show description
Tecton | UI, Data-Viz, Backend, Data Infra | San Francisco & New York City | OnsiteAt Tecton, we are building a new kind of AI infrastructure that is transforming the way companies solve real-world problems with machine learning at scale. Our founding team created Uber's Michelangelo ML Platform (https://eng.uber.com/michelangelo/), which has become the blueprint for modern ML platforms in large organizations. We are well funded by top-tier VCs, have paying enterprise customers, and have excelle...
remote full-time 314w ago
Show description
DuckDuckGo - We are looking for candidates that are excited to join us on a mission to raise the standard of trust online. All of our roles are fully-remote, except where specific locations are noted.DuckDuckGo | Senior Public Policy Manager (US) | REMOTE (Washington, DC area)DuckDuckGo | Senior Public Policy Manager (EU/UK) | REMOTE (Brussels, Belgium)DuckDuckGo | Director, Frontend | REMOTEDuckDuckGo | Director, Mobile | REMOTEDuckDuckGo | Senior Site Reliability Engineer | REMOTEhttps://duckd...
onsite Product Managers, Salesforce Admins, Engineers full-time 314w ago
Show description
Lambda School (YC S17) | Product Managers, Salesforce Admins, Engineers | San Francisco, Utah | ONSITE, Remote | FulltimeLambda School is building the world’s best and risk-free coding school. Students pay nothing until they get a high-paying job. We’re on a mission to unlock everyone’s potential regardless of circumstance by becoming the best place in the world to launch a new career.We are hiring rock star Product Managers, Salesforce Admins and FullStack Engineers.(1) Product Manager: https:/...
remote Remote DevOps Engineer full-time 314w ago
pythonrubypostgresqlredisgcpdockerkubernetesansible +1
Show description
CareMessage (YC W14) | Remote DevOps Engineer | Remote (North, Central or South America) | Full Time | https://www.caremessage.org/careersCareMessage is a non-profit dedicated to using mobile technology to improve healthcare outcomes for underserved patient populations. Our web-based platform allows healthcare providers to reduce no-shows, increase attendance to preventive care screenings, and improve chronic disease management- all via simple “nudges” sent through text message.We are looking fo...
remote Senior Data Engineer full-time 314w ago
Show description
Warby Parker | Senior Data Engineer | New York, NY or Remote | Full-time | OnsiteWarby Parker is out to prove that businesses can scale, be profitable, and do good in the world. We’re on the lookout for a motivated Data Engineer to help build, scale, and maintain our ETL pipelines and to help develop integrations between our rapidly growing tech systems and our data warehouse. As a member of the Data Engineering team your efforts to collect, organize, and share data will impact nearly every empl...
remote Senior Frontend Engineer, Senior Backend Engineer full-time 314w ago
elixirreactphoenixpostgresqlherokugraphql
Show description
Distru (https://www.distru.com) | Senior Frontend Engineer, Senior Backend Engineer | Oakland, CA | REMOTE | Full-TimeDistru is a software platform for the cannabis supply chain. Our product helps cannabis companies manage production, sales, invoicing, and shipments, automating compliance with complicated state regulations that require real-time inventory tracking gram-by-gram. We are growing rapidly with over $700M in transactions per year passing through our platform, and we're uniquely positi...
onsite Software Engineer full-time 314w ago
javascriptpythonreactdjangopostgresqlelasticsearchneo4jaws +4
Show description
peregrine.io | Software Engineer | San Francisco, CA | Full-time | ONSITEFounded in 2018, Peregrine creates technology to help governments transform the way they fight crime while building trust with their communities. We do this through openness, accountability, careful policy enforcement, and respect for people’s personal freedoms. Our platform fuses disconnected government data silos across secure networks and empowers users with highly intuitive interfaces to search, analyze, and collaborate...
onsite San Francisco, CA full-time 314w ago
javascripttypescriptswiftobjectivecreactnodejsiosandroid
Show description
Airtable | San Francisco, CA | Onsite or remote (USA only) | Software Engineer, Product Engineer, Data Engineer, Data Scientist, SREAirtable's mission is to expand human productivity by letting everyone create tools to organize their world. Our current product includes a real-time collaborative database and a rich set of components for building tools using this database. Unlike single-purpose apps, we think of Airtable as a toolkit of building blocks that people can repurpose to create their own...
onsite San Francisco, NY, London full-time 314w ago
rubyswiftkotlinreactrailsreact-nativeiosandroid
Show description
Coinbase (YC S12) | San Francisco, New York, London | Onsite | https://www.coinbase.comDigital currency will bring about more innovation, efficiency, and equality of opportunity in the world by creating an open financial system. We can use this new technology to help good ideas spread faster, reduce the inefficiencies that legacy payment networks impose on the world, and provide access to financial services to several billion people in the developing world.I've personally been here for 3 years a...
onsite full-time 314w ago
Show description
Love getting the jump on this. It's especially important now that companies tell us about their process so that we can compare and expedite, including how many:- technical phone screens- video interviews- projects (esp. length and duration, paid/unpaid, etc)- portfolio / code reviews on past projects- onsite interviews and if there's any whiteboarding or pairing, etc. [note: please tell us if these are virtual now]As well as the total amount of time you expect interviewing to take! Thanks :)
onsite big data/predictive analytics/predictive modeling full-time 314w ago
Show description
Datxe | big data/predictive analytics/predictive modelingMontreal QC | On-site |We are looking for:- (3) Junior "Quants" (Fresh out of School)- (2) Marketing "Genius" (Fresh out of School)Email me your CV: nostradedamus@gmail.com
onsite Software Engineer full-time 314w ago
Show description
TestFit | Software Engineer | Dallas, TX | Full-time | OnsiteWe design buildings in milliseconds. Desktop software written in plain old C. See it in action here: https://blog.testfit.io/.If you like managing your own memory, optimizing algorithms to run in under a millisecond, and solving tough spatial problems using 2D vectors and trigonometry, then we might be the company for you. Being prone to ranting about how much RAM Slack uses is also a good sign.The full job description and application ...
remote Full Time full-time 314w ago
vuenodejspostgresqlredisawsterraform
Show description
CNN Digital | Full Time | New York, Atlanta, RemoteTech manager: 3-5+ years, previous dev work required, focusing on hiring and guiding dev effort.
Senior Software Dev: (Nodejs, Vue, Postgres, Redis) working on green field webapp for cnn.com.
Site Reliability Engineer: Working in AWS environment with many aws managed services very familiar with cloudformation/ terraform.for more info email: stuart.ross@cnn.com
onsite Bedford, MA ONSITE full-time 314w ago
Show description
iRobot | Bedford, MA ONSITE | Embedded Software Engineers | https://www.irobot.com/about-irobot/careersI'm hiring an experienced embedded software engineer for my team at iRobot in Bedford, MA (just outside of Boston) [0]. Join me in making helpful home robots!I've also got a 0-2 year experience embedded software role that doesn't have a job description yet: it's basically [0] with less experience.iRobot is hiring a bunch of other software engineering positions as well. See all open positions at...
onsite Campbell, CA full-time 314w ago
Show description
Barracuda Networks | Campbell, CA | https://www.barracuda.com | Full-time | OnsiteWe are looking for someone to join us at Barracuda. Our team is developing an innovative security product that focus on sophisticated email attacks. The product detects and visualizes advanced threats, such as conversation hijacking and account takeover.Our positions:* Principal Frontend Engineer: http://jobs.jobvite.com/barracuda-networks-inc/job/o65TbfwZ* Principal Backend Engineer: http://jobs.jobvite.com/barrac...
full-time 314w ago
Show description
We are hiring at Discord https://discordapp.com/jobs
onsite Associate Director / Director, Machine Learning full-time 314w ago
machine-learning
Show description
Thrive | Associate Director / Director, Machine Learning | Cambridge, MA | Full-time | Onsite |
https://thrivedetect.com/come-to-thriveThrive is passionate about our mission to integrate earlier #cancer detection to empower longer, healthier lives. We are seeking a highly motivated Associate Director/Director, Machine Learning to join our Biostatistics and Informatics team in Cambridge, MA. The successful candidate will be responsible for developing Machine Learning strategies with multi-omics a...
Burlingame, CA (flexibility for WFH) full-time 314w ago
rubyrails
Show description
Framework | Burlingame, CA (flexibility for WFH) | Senior Backend Developer | Full timeFramework’s mission is to fix consumer electronics. We believe products can be better both for users and the environment by building them to have long usage lifetimes and designed-in serviceability. Unlike most electronics products on the market today, ours are modular and can be repaired and upgraded by the average user.Our team comes from successful consumer electronics startups including the founding team o...
onsite San Mateo, CA full-time 314w ago
javascriptpythonjavalua
Show description
Roblox | San Mateo, CA | Full Time | ONSITE (Remote during Shelter In Place)We are actively hiring and all interviews are currently done via phone & zoom.Roblox is ushering in the next generation of entertainment, allowing people to imagine, create, and play together in immersive, user-generated worlds. We are recruiting across multiple teams and positions. Our top priority roles are:Technical Artist: 5+ years’ experience; Proficient in C++, Lua, Python and/or JavaScriptBackend Web Engineer: 5+ ...
onsite Full-Stack Engineer / Tech Lead full-time 314w ago
pythonreactaws
Show description
Partoo | Full-Stack Engineer / Tech Lead | Paris, France | Full-time | Onsite | https://www.partoo.co/en/We keep synchronized and up to date your business information on all major online platforms as Google + Google Maps, Facebook, Apple Maps, Foursquare, etc.. For example, those past days we helped tens of thousands of business updating their opening times regarding coronavirus. Like this, we avoided people doing unnecessary trips to a closed business.We're looking for several Full-stack Engine...
onsite Northern VA full-time 314w ago
javascriptjavareactangularnodejspostgresqlmongodbandroid
Show description
Ridgeline International | Northern Virginia | Onsite
At Ridgeline International, we focus on challenging problems. We deliver innovative technical solutions to overcome obstacles experienced at the tactical, operational, and strategic levels. We iterate quickly and deliver boutique, agile, and tailored solutions to address the exact needs of our US Government customers.Our Stack:Angular, React, LeafletJava, Node.jsPostgres, MongoDB, & Elastic SearchAndroidIf you want to build awesome tech come c...
remote Full-Time full-time 314w ago
phplaravel
Show description
Touchstorm | Full-Time | Remote within IndiaWe’re looking for a Backend Engineer with experience in PHP (particularly in Laravel). We have an office in Mumbai, and we are primarily looking to expand this team with an option to work remotely.Touchstorm is YouTube agency that is building out a YouTube platform for creators and brands. We are on a mission to organize YouTube data. You apply for this job here: https://www.touchstorm.com/sr-web-engineer/
remote NYC, SF, REMOTE (USA) full-time 314w ago
Show description
Cockroach Labs | NYC, SF, REMOTE (USA) | Full-timeCockroach Labs is hiring a variety of positions including engineers, engineering managers, developer relations.https://www.cockroachlabs.com/careers/Please apply using the above link.It's a great place to work, with interesting distributed systems and storage problems to solve, and we're accepting remote candidates at this time.Check out our blog: https://www.cockroachlabs.com/blog
onsite 1- Community Manager, 2- UI/UX/Design full-time 314w ago
Show description
Species File Group | 1- Community Manager, 2- UI/UX/Design | 1- ultimately ONSITE, 2- REMOTE/INTERNS considered | Full-time | USA, U. of Illinois, Champaign/UrbanaWe're an endowed group housed that University of Illinois building open source software for scientists studying the Earth's biodiversity. Join a great small team with lots of experience in a relatively stress free environment. Our job descriptions are here [1].[1]: https://speciesfilegroup.org/who.html
remote REMOTE full-time 314w ago
apache
Show description
NetFoundry | REMOTE | Full-time | https://netfoundry.ioOur platform enables cloud native networking.Programmable, secure-by-design (zero trust) and embedded in applications via our SDKs. Turnkey NaaS solutions and OSS (Apache v2) solutions.Join us to help reinvent networking. Remote and on-site positions (at several pod locations) are available, and we are a remote-first company.We are adding to several teams:Marketing: https://netfoundry.io/careers/marketing/Development: https://netfoundry.io/c...
remote Leesburg, VA and REMOTE USA full-time 314w ago
Show description
Cofense | Leesburg, VA and REMOTE USA | UI Front End Software Engineer II | https://cofense.com/company/careersCofense was founded by information security experts, with decades of industry experience and a mission to unite humanity against phishing. Cofense fosters an environment that is challenging and fun. We put our employees first by mentoring new team members, encouraging company paid training, and making sure we have fun.Cofense is looking to hire people that take pride in their work, enjo...
remote San Francisco, CA and REMOTE full-time 314w ago
java
Show description
Code for America | San Francisco, CA and REMOTE | Engineers (1x Security Eng, 1x Senior Eng with Java), Community Organizers | https://www.codeforamerica.org/jobsCode for America is a non-profit that builds a government that works for the people, by the people, in the digital age. We believe government services need to be simple, effective, and easy to use, working at scale to help all Americans, starting with the people who need them most.Especially in the time of Coronavirus, millions of Ameri...
Intermediate/Senior Software Engineers (Full-stack, Backend, Frontend) full-time 314w ago
phpluavuenodejsmysqlredisinfluxdbaws +1
Show description
Jumbleberry | Intermediate/Senior Software Engineers (Full-stack, Backend, Frontend) | Toronto Canada, Santiago Chile | Full timeAt Jumbleberry, we build platforms and services that power modern customer acquisition at scale. We help brands of all shapes and sizes profitably acquire customers through paid media. We’re very much unlike traditional advertising because when our clients don’t make money, neither do we.We build analytics pipelines, recommendation engines, distributed systems, and kil...
onsite Machine Learning Engineer (Deep Learning) full-time 314w ago
pytorchtensorflowmachine-learning
Show description
Cortx | Machine Learning Engineer (Deep Learning) | Baltimore, Maryland | Onsite, Full-timeCortx is a profitable, stable, and growing artificial intelligence startup that is building a tool that automatically writes content about any subject with the same level of quality, factual accuracy, and usefulness as a human.You would be at the intersection of research and production code - taking our research roadmap and helping make it a reality.This will involve training new models and making improvem...
full-time 314w ago
machine-learningblockchain
Show description
We're hiring a ton at Coinbase (https://coinbase.com) right now for pretty much every team: backend, frontend, data, ML, infra, sre, dev exp, em's etc.We have a great culture and it's a fantastic place to work. I'm learning more than I ever have in my career and it's fun to be working in the blockchain/crypto industry.Incredible benefits and comp.If you're interested, shoot me an email at bradley.herman [at] coinbase.com and I'll put you in our system
onsite Various roles full-time 314w ago
rustjavaaws
Show description
Amazon Web Services (AWS - Game Technologies group)| Various roles | Seattle | Full-time, Onsite | https://aws.amazon.com/gametech/I am the hiring manager or skip-level manager for all these open roles so feel free to email me with questions. We have mid to senior level software development engineering roles open as well as an engineering manager role. We work on cutting edge tech that helps games run on AWS and scale in ways they couldn't alone. I am looking for people with distributed service ...
remote Full Stack Engineer full-time 314w ago
javascripttypescriptreactnodejspostgresqlreact-nativegraphql
Show description
Atom Finance (https://atom.finance) | Full Stack Engineer | usually Brooklyn, remote at the moment | Full time
Atom is a venture-backed well-funded FinTech startup building the next-generation investing platform (https://techcrunch.com/2019/12/12/atom-finance). Our mission is to empower everyone to make informed investment decisions by democratizing access to institutional-quality resources.Stack: Node.js / React / React Native / Typescript / GraphQL / PostgreSQLWe are looking for multiple roles...
remote Full-Time / Intern full-time 314w ago
pythonrust
Show description
MeetKai | Full-Time / Intern | REMOTE | Los Angeles / US / China | 50-180K + Equity for qualified candidatesWe are a stealth-ish startup in the conversational AI space, co-founded by a founder of a >10bn cap tech company. We are hiring Engineers of all levels, If you are drawn to any of these bullet points email hello@meetkai.com to hear more.* Being scrappy about collecting a dataset* Building models based on latest academic research and internal R&D* Making sure you can actually deploy a model...
remote iOS, Android, Product full-time 314w ago
iosandroid
Show description
Carv by MotionMetrics | iOS, Android, Product | London, UK and/or Innsbruck, AT | Full-time + Remote/onsite | https://getcarv.com/lp/careers-android-engineer (Only Android posting is live right now)At MotionMetrics, we’re working to create digital sports coaching experiences. Our first product is Carv, a digital skiing coach that blends hardware, software and real-time audio instruction to teach people the sport of skiing - a world first across sports.We’ve shipped 12,000 units to date and are d...
remote Technical Content writer + head of Dev Rel full-time 314w ago
Show description
QuestDB | Technical Content writer + head of Dev Rel |Remote, London/SFQuestDB is a an open source SQL database to process time-series, faster. The founding team comes from low-latency trading; fast software are part of our DNA. Through QuestDB, companies can harness the power of real-time and big data processing in a wide array of use cases and industries, from financial data to IoT and connected cars.We have to just raised $2.1m from leading European VCs and are building the team.Helping devel...
onsite SDE, SDE II, Senior SDE, PM and Senior PM full-time 314w ago
Show description
Microsoft OneNote | SDE, SDE II, Senior SDE, PM and Senior PM | Full-Time Onsite | VisaThe Microsoft OneNote team is working on OneNote, Sticky Notes and other new apps we can't talk about yet. We are looking for people who We believe in empowering people to Remember, think, organize and act. We are creating a single place for all your notes, no matter where you are.https://aka.ms/notesjobs
full-time 314w ago
Show description
Nobody ever needs FPGA engineers? Maybe we should do a separate thread for gateware/hardware people?
onsite full-time 314w ago
Show description
Kind of tone-deaf these all say "onsite"
NY, USA full-time 314w ago
Show description
Ribbon Health | New York, USA | Full-time | https://jobs.lever.co/ribbonhealthWe’re looking for entrepreneurial software engineers who are motivated by our mission to simply healthcare. We’re building an API layer that powers the workflows of healthcare providers, care navigation platforms, health plans, and emerging digital health companies. You’ll be involved throughout the product lifecycle and collaborate closely with technical and non-technical stakeholders to understand our customers’ use ...
remote NYC, LA, Oakland, Charlotte and remote full-time 314w ago
Show description
Better.com | NYC, LA, Oakland, Charlotte and remote| Full stack, front end, and variety of biz roles | https://better.com/about-us/careersHelping average americans get the best rate on a mortgage. Grew 600% last year with profitable unit economics. Doing 2K+ mortgages/mo.Dev team of 60 sits mostly in NYC.
remote Devops/On call full-time 314w ago
ocamllinux
Show description
Ahrefs | Devops/On call | REMOTE ok (Americas time zones) | https://ahrefs.com/jobs/devops-oncallWe are looking for a Site Reliability Engineer with deep knowledge of Linux and distributed systems to help take care of its distributed crawler and ensure all systems are up and running 24/7. Working experience with bare-metal servers and ability to participate in daily on-call rotation are required.Our system is big part custom OCaml code and also employs third-party technologies - Debian, ELK, Pup...
remote The company behind Ubuntu full-time 314w ago
python
Show description
Canonical | The company behind Ubuntu | Software Engineer for Ubuntu Server | Americas or Western Europe Time zones | REMOTE | Full-TimeCanonical has an opening [1] on the Ubuntu Server team. This role would be working on the cloud-init [2], curtin [3], and Ubuntu Advantage Tools [4] Python projects. If you like working with customers, clouds, writing Python, and working in Open Source this would be a great experience for you. Again, this is a full-time, remote position for someone in the Americ...
Software Engineer (Computer Vision/C++/Python) full-time 314w ago
python
Show description
Magic Leap | Software Engineer (Computer Vision/C++/Python) | Full-time | Sunnyvale/San Francisco/Fort Lauderdale/Zurich/Tel-Aviv/TorontoWe're looking for engineers and researchers who can help us build the next generation of our perception systems (SLAM, eye tracking, world modeling, hand tracking and more).CV researcher / engineer: https://boards.greenhouse.io/magicleapinc/jobs/1719911Software engineer (high performance C++): https://boards.greenhouse.io/magicleapinc/jobs/1731904https://www.ma...
onsite Cambridge, MA full-time 314w ago
Show description
Wistia | Cambridge, MA | Full-Time, Onsite + Remote | https://wistia.comWe're a profitable, long-term thinking oriented company serving up our business customers' videos and shows. Read more about what we believe in here: https://wistia.com/about/valuesOpen engineering roles:* Lead Front End Engineer: https://boards.greenhouse.io/wistia/jobs/2045608* Senior Software Engineer, Infrastructure: https://boards.greenhouse.io/wistia/jobs/2045719If you've got any questions feel free to DM me here or on...
Frontend, Backend, Data Eng, PM full-time 314w ago
Show description
Polarr | Frontend, Backend, Data Eng, PM | Bay Area Full-time
https://www.polarr.com/careersPolarr has the largest repository of user created visual effects in the world. We help creators make, distribute, and monetize their own visual languages through a ecosystem of apps. We're building our first community product (in stealth). We're backed by the same early investors of Twitter, Tumblr, Giphy and Patreon with founders from Stanford engineering and senior leadership from Twitch, Airbnb and Goo...
remote Engineers full-time 314w ago
Show description
Repl.it (YC W18) | Engineers | SF or REMOTE | https://repl.it/jobsRepl.it is the first massively open computing platform where anyone, even without even needing an account, can hop on and in seconds start executing code, build and host applications and websites, and collaborate with other people.Providing a service like this is challenging from all a scaling, security, and billing perspectives. Also, supporting the number of languages we do (https://repl.it/languages) is a hard tooling problem -...
onsite SF, Vienna, Toronto, and Boston full-time 314w ago
sentry
Show description
Sentry | SF, Vienna, Toronto, and Boston | Full-time, onsite | https://sentry.io/jobsHey folks, Sentry is building application monitoring tools to help teams triage and debug their production software. If you want to selfishly write software that solves your own problems, Sentry could be the place for you.We're hiring Software Engineers, Solutions Engineers, Support Engineers, and Account Executives in four cities: SF, Vienna, Toronto, and Boston.More here: https://sentry.io/jobs
remote NY, San Francisco, Remote (USA) full-time 314w ago
goswiftkotlinexpressgcpiosandroid
Show description
byte | New York, San Francisco, Remote (USA) | Full Time | iOS/Android/Golang | https://byte.cobyte is an app where creators make looping 6 second videos, from some of the same people that brought you Vine. Our goals are to democratize creativity and give our audience tools to make creative, interesting, and unique content.We launched at the end of January and have fundraised enough to get us to our next goal. Our technical stack includes Go, Google Spanner, and Google Cloud Platform for the bac...
onsite full-time 314w ago
javascripttypescriptvuenodejs
Show description
Virginia Cyber Range / Blacksburg, VA / ONSITE / can support VISA / Software Developer (TypeScript/Node.js/Vue)We're a state-funded organization attached to Virginia Tech (same benefits as provided through University). We provide a platform, community, and courseware to support cybersecurity education in the state's public K-12 and higher education. We leverage "the cloud" to spin up hundreds of thousands of virtual machines so students can practice real hacking offense and defense. By popular d...
remote REMOTE full-time 314w ago
Show description
Automattic | REMOTE | Full Time | Fully-distributed workforce (70+ countries & counting)We run WordPress.com, Tumblr, WooCommerce, WordPress VIP, Jetpack, Longreads, Simplenote, Happy Tools, CrowdSignal, Gravatar, and more.Want to make the web a better place for more than a billion people each month? We’re hiring!Here are our open positions:https://automattic.com/jobs/https://wpvip.com/careers/And information about how we work:https://automattic.com/work-with-us/
San Francisco, CA + Providence, RI full-time 314w ago
Show description
Zumper | San Francisco, CA + Providence, RI | Engineering, Product, Design, SalesZumper is building the future of apartment rentals, making renting an apartment as easy as booking a hotel. We've just raised a $60M series D, and are now the largest privately held rental marketplace in the US (one in three Americans will use us this year). We're proud to be one of Inc Magazine's "Best Places to Work" and have a solid technology stack + lots of interesting problems to work on at scale.Open roles: h...
USD 150k-162k/yr remote Senior Full Stack Engineer full-time 314w ago
javascriptphpreactpostgresqlmysqlredis
Show description
Follow Up Boss | Senior Full Stack Engineer | Remote | $150K - $162K | Full-time | https://www.followupboss.com/aboutWe are a simple, sales-focused CRM for real estate teams. We’re a bootstrapped, profitable company started back in April of 2011. We are a remote company with a mostly US-based team. We are very customer-centric: https://www.facebook.com/followupboss/reviews and our customers love our product.We are looking to hire a Senior Full Stack Engineer. Solve challenging technical problems...
onsite Research Engineer full-time 314w ago
machine-learning
Show description
CTRL-labs (part of Facebook Reality Labs) | Research Engineer | NYC | Full-time, Onsite | https://www.ctrl-labs.com/Facebook Reality Labs is looking for Research Engineers to help us unleash human potential by erasing the bottlenecks between intent and action. Our neural interface research and development lies at the intersection of computational neuroscience, machine learning, signal processing, biophysics, and human-computer interaction.
As Research Engineer, you will: drive cutting edge resea...
onsite Full stack engineer full-time 314w ago
reactnodejsexpresspostgresqlheroku
Show description
Substack (W18) | Full stack engineer | San Francisco | Onsite | https://substack.comSubstack lets writers start their own subscription publication - think paid blog/newsletter - where writers' and readers' incentives are aligned.Over 50k people pay to subscribe to publications, and top writers are making six figures.We use Node, Express, and Postgres on top of Heroku. React for frontend. Simple & effective so we can focus on solving problems for users.We are 10 people. We raised a series A from ...
onsite South San Francisco, CA full-time 314w ago
pythonpostgresqldockerkubernetespytorchmachine-learning
Show description
Genesis Therapeutics | South San Francisco, CA | Onsite (Flexible WFH) | Full-time | https://www.genesistherapeutics.aiWe’re a hybrid AI + biotech company, developing novel neural networks to predict molecular properties and using them to accelerate the development of new medicines.Looking for great software engineers and ML researchers with an interest in drug discovery -- no biology or chemistry experience required. We all learn from each other here.- We currently have a small team of excellen...
onsite Java/Kotlin Developer full-time 314w ago
javakotlin
Show description
Springer Nature | Java/Kotlin Developer | London | Full-time, Onsite | https://sndigital.springernature.com/At SN Digital we maintain and deliver millions of articles used by researchers, scientists and students around the globe. We offer a non-hierarchical environment where everyone can contribute meaningfully to the direction of the products and the department. We believe in continuously delivering high quality solutions to our customers, and empowering teams to do this. You'll be able to see ...
onsite Various Engineers full-time 314w ago
expressios
Show description
PBS | Various Engineers | Full-Time | ONSITE (Flexible WFH) | Alexandria, VAPBS serves the American public with programming and services of the highest quality, using media to educate, inspire, entertain, and express a diversity of perspectives. We're hiring engineers for multiple platforms to build the PBS Kids and General Audience video products:• Senior Backend Engineer - https://tinyurl.com/v7c8nb2
• Senior Frontend Engineer - https://tinyurl.com/stab99u
• Full Stack Web Engineer - https://t...
full-time 314w ago
grafana
Show description
https://grafana.com/
onsite Sophia Antipolis, Nice Area, France full-time 314w ago
javascript
Show description
Dailymotion | Sophia Antipolis, Nice Area, France | ONSITE | Junior / mid-level JavaScript developer | Full-timeMy team (video player core & performance) is looking for someone with 1-3 years of JS experience. You need have some basic level of familiarity with vanilla JavaScript and be willing to learn. No knowledge about video stuff required.We're currently 14 people in the Sophia office, including 3 in my team. The two main sites are Paris and NYC with ~400 people. Dailymotion is owned by Vive...
remote Full Stack Engineers, Product Managers, Senior QA full-time 314w ago
rubyreactrailspostgresqlheroku
Show description
Silversheet | Full Stack Engineers, Product Managers, Senior QA | Los Angeles, CA + San Diego, CA + Portland, OR | REMOTESilversheet is a healthcare SAAS startup, creating modern medical credentialing software. We make it easier for hospitals and clinics to hire doctors, nurses, and allied health providers. AMN Healthcare ($AMN) acquired Silversheet last year, providing us with the resources needed to continue our focus of putting patients over paperwork.To round out our ~15-person strong engine...
onsite SF full-time 314w ago
reactrails
Show description
Atlassian Statuspage | SF | Full Time | Onsite (but not right now) | Full Stack & Back End | https://www.statuspage.ioStatuspage helps companies large and small keep customers informed around outages and incidents.We run a Rails backend and a React frontend. Because it's critical for us to be up when our customers are down, we're more focused on reliability and uptime than most products.We're a fun, close-knit crew of 24 in engineering, and about 40 across all functions. Working inside Atlassian...
remote London full-time 314w ago
Show description
Speckle | London | VP/Exec Commercial/Strategy | Full-time | RemoteOur mission is to build the open source data platform for the AEC (architecture, engineering & construction) and foster a community of hackers and builders that will digitally transform the built environment.We're looking for someone with a strong record of commercial, operational and strategic experience in the COSS landscape/early stage startups. AEC experience is welcome, as well as an emphatic and generous approach to creatin...
Austin, TX, Full-stack engineers full-time 314w ago
goreactvuenodejspostgresqlnats
Show description
Routefusion | Austin, TX, Full-stack engineers | Full-timeWe are an international payments/payouts API. We are focused on best engineering practices, solving extremely hard problems, and writing great documentation. Our team is based in Austin, TX, but have employees on three different continents.Our stack is Node, Golang, K8's, Nats, Postgres, Vue/React.We are backed by some amazing investors and have phenomenal customers. If you want to be early at a company that has great growth potential, so...
remote Full Stack Software Engineer full-time 314w ago
elixirreactphoenixpostgresqlgcpkubernetesgraphql
Show description
Vetspire | Full Stack Software Engineer | Austin, TX | Full-Time | https://vetspire.comVeterinary medicine is one of the essential services needed to be provided during the coronavirus pandemic. Every day, veterinarians risk themselves to take care of your pets, and we're working every day at Vetspire to build them the tools to do so while following social-distancing best practices.Vetspire is an AI-driven medical records and practice management platform for veterinarians. We’re a startup that b...
San Francisco, CA (SoMA) + Paris, France full-time 314w ago
Show description
Frontapp | San Francisco, CA (SoMA) + Paris, France | Engineering, Product, Design, Data, Sales | Full-time | https://frontapp.com/jobsEmail is the universal communication tool for work. It’s where you discuss work, answer questions, and talk to all of your customers, vendors, and partners. But email wasn’t made for business and hasn’t evolved to help you work with a team. So you’re dropping the ball, missing important context, and relying on many siloed apps that make you less productive as a w...
remote Toronto, On, Canada full-time 314w ago
javascriptgoreactnodejspostgresqlawsgcpdocker +3
Show description
Commit | Toronto, On, Canada | Fullstack/Senior Software Engineer or DevOps Engineers | Full-timeSite: Remote (Canada only)Techstack: React/redux, Golang/node.js, GraphQL, Postgres, AWS/GCP, Docker, Kubernetes/Terraform/EKSCommit (https://commit.dev) is trying to improve the engineering career experience by 10x and de-risk the path that engineers have to take. No need to worry about balancing passion versus stability, we become the buffer so you can continue to learn and grow.Contact phong@commi...
full-time 314w ago
javascriptpythonembernodejsdockerkubernetes
Show description
AuditBoard (3rd on Deloitte Fast 500) is streamlining enterprise risk management and compliance through our SaaS platform (SOX, NIST, PCI, etc). If you're interested in working at a fast growing company building enterprise software that is loved by its users, please get in touch.- Node.js, Ember.js, Kubernetes, Docker, C#, Python
- Small team, lots of independence, flexible schedules
- Contribute to open-source projects
- Fast paced & growingLooking for:- Senior Full Stack Engineers
- Senior Pro...
onsite Los Angeles (Playa Vista) full-time 314w ago
reactnodejsiosandroid
Show description
Griddy | Los Angeles (Playa Vista) | Full Time | Onsite & Remote | Backend, Frontend, Mobile, QA, DataGriddy is an energy provider in Texas innovating on how we consume this resource together (clean-tech). We are revenue profitable and are preparing for growth.We have great team and are hiring at all experience levels.Tech Stack: React (Web), Go, Native Android, Native iOS, and NodeMail to saumya.garg AT gogriddy DOT com to talk
remote Remote or SF (fully remote currently) full-time 314w ago
Show description
Loom | Remote or SF (fully remote currently) | Many open roles | Full-timehttps://www.loom.com/companyLoom is empowering people around the world to create quick videos–of their screen, of themselves, or both. More than 2 million users across more than 60,000 companies are using Loom to communicate more effectively.Personal video pitch from me:https://www.loom.com/share/9bbdfd8cf86f46c1af73ff4822b5c80f
remote UX Designers, UI Engineers, Technical Writers full-time 314w ago
Show description
CrowdStrike | UX Designers, UI Engineers, Technical Writers | | Remote USA, UK | Full-timeCrowdStrike is one of the world's leading cybersecurity companies, using cutting edge technology to protect our customers from the most sophisticated adversaries. We IPO'd last year and we aren't slowing down. We're a remote-first organisation (and have been since day one) and distributed across the US & Europe. The UX team is looking for talented designers, writers & engineers to help build interfaces used...
onsite Seattle full-time 314w ago
Show description
Jobscan.co | Seattle | Full time / Onsite | Director of Engineering and Senior Software Engineer Roles
Jobscan is a fast-growing start-up in the heart of historic Pioneer Square, Seattle, WA. Jobscan is web service that helps job seekers land more interviews by using AI to analyze one’s resume or LinkedIn profile against any job description. We're building the next generation of job search tools to make job search easier. We’re user-funded, profitable, and growing exponentially.We are looking fo...
remote All Positions Remote full-time 314w ago
kubernetesansible
Show description
Red Hat | All Positions Remote | Everything | https://www.redhat.com/en/jobsRed Hat. You know who we are. We're also the world's top Kubernetes provider with OpenShift (well over 1000 customers). We're Ansible. We're OpneShift Dedicated and OpenShift Online (Hosted services). We're a huge company with openings in marketing, management, VPs also! We're worldwide. We have offices around the globe. We're all remote: the location listed in a job posting is where the manager is located. 90% of the ti...
onsite NYC full-time 314w ago
pythonjavareactawsmachine-learningspark
Show description
dMetrics | NYC | Frontend, Backend, Algorithms Eng | Onsite- Zero-code, end-to-end NLP framework for non-technical subject matter experts (i.e., people other than us). This means Internet scale data ingestion, near-deduplication, interactive pipeline orchestration, training & annotator management, visualization, signal validation.- We are usually called upon when the usual run-of-the-mill solutions fail (serve grade A clients).- Open positions for senior backend, frontend, and algorithms enginee...
remote NYC, NY full-time 314w ago
Show description
Clyde | NYC, NY | Full Time | Currently remote during quarantine | FS Engineers (https://www.joinclyde.com/company/about#jobs)Clyde empowers businesses—from startups to enterprises—to offer extended warranties and accident protection to their customers. Our plans slot into your current purchase flow so you can be up and running in minutes.
remote Staff / Senior Engineer full-time 314w ago
Show description
Hustle, Inc. | Staff / Senior Engineer | Remote or SF | Full-time | https://hustle.com
Hustle enables organizations to run large-scale text messaging campaigns by empowering their team members and volunteers to efficiently have thousands of personal 1-to-1 conversations.Conversations driven by our platform are geared towards driving measurable meaningful outcomes such as voter turnout, event attendance, or dollars raised for clients such as PlannedParenthood, Sierra Club, the DNC, large non-prof...
San Francisco, CA full-time 314w ago
javascripttypescriptreactnodejsreact-native
Show description
Wanderlog (YC W19) | San Francisco, CA | Full-stack Software Engineer, Front-end Software Engineer | Full-timeWanderlog (https://wanderlog.com) is building tools to make leisure travel easier. We believe that travel makes us and the world better, and are trying to lower the bar to it. Our product so far is a Google Docs for planning travel and sharing recommendations.We’re currently a team of 5, including 4 engineers (counting twin-brother founders Peter and Harry as engineers) and 1 designer. O...
onsite Senior Software Engineer full-time 314w ago
linuxunix
Show description
Lambda | Senior Software Engineer | San Francisco, CA (Dogpatch) | Onsite | Full TimeWe're looking for a software engineer who wants to write code at our Deep Learning workstation and server company. You will:* Be responsible for the full stack* Build reliable, scalable, highly available systemsRequired Experience:* Bachelor's degree in technical field (CS, Physics, EE, Math, etc.)* Extremely comfortable in a Linux/Unix shell===We're located in San Francisco 5 minutes away from the 22nd street C...
USD 70k-90k/yr remote Lead Programmer/Developer full-time 314w ago
gitlab
Show description
Sagri | Lead Programmer/Developer | Tokyo (Remote-First) | Full-Time | $70K - $90K + Stock> Sagri is an Asia-focused AgTech Startup, helping farmers live a happier life. We help farmers with easy-to-access credit and educate them in increasing their earning potential. We leverage satellite imagery and our proprietory soil sampling technology.We are a remote-first Startup. We do have our offices in Tokyo and Bangalore. Our current website (Japanese) is at http://sagri.tokyo/, which is being repla...
GoingMeta.io GmbH, Vienna Austria Europe full-time 314w ago
javascripttypescriptpythonreactnodejspostgresqlawskafka
Show description
Growth Hackers | GoingMeta.io GmbH, Vienna Austria EuropeTech we're using: React/Redux, Typescript, Node.js, Kafka, Python, Postgresql, and AWS.
onsite Full-Stack & Back End Software Engineers, QA, SDET, Project Managers full-time 314w ago
javaspringmysqlawsdocker
Show description
Natera | Full-Stack & Back End Software Engineers, QA, SDET, Project Managers | San Carlos, CA + Austin, TX | ONSITE (remote during isolation) | Full-time, visa okNatera operates genetics lab testing for healthcare in the reproductive + women's health, organ transplant, and oncology spaces. Engineering builds all the internal and external software that makes that process flow and gets diagnostic results to the people.We're looking to expand engineering capabilities in San Carlos, and build out a...
onsite Full-Stack & Front-End Engineers full-time 314w ago
Show description
Replenysh | Full-Stack & Front-End Engineers | Orange, CA | ONSITE (WFH at the moment) | Full Time•••ABOUT•••We are building the operating system of material recovery, using technology to put an end to landfills and ocean pollution.•••APPLY•••https://replenysh.com/careers
onsite Kaunas, Lithuania full-time 314w ago
gophpreact
Show description
Eneba | Kaunas, Lithuania | Full Time | Onsite (remote while quarantine is in effect) | Backend, frontend developer | https://www.eneba.com/Eneba.com is a newly established marketplace for games. With a huge selection of titles at the best price, Eneba is quickly becoming a go-to place to find the best game deals. While game collection in the market grows by the day everyone can find something for their liking - fresh new games, world-renowned game titles or various console giftcards.Our merchan...
remote REMOTE or Oakland full-time 314w ago
Show description
WattTime | REMOTE or Oakland | Many open roles | Full-timeWattTime[1] is an environmental tech nonprofit that helps devices be smarter about using green energy. We are also moving into some satellite-based emissions monitoring efforts [2]. We are hiring for many roles: analysts, operations, engineering, data science, and an unposted GIS/physics role [3]. Small team, good people, good work, remote-friendly. Hope to see your application soon. Email me (shawn@watttime.org) with any questions.[1] ht...
onsite React.js Developer full-time 314w ago
javascriptrubyreactnodejsrailspostgresqlredis
Show description
Ideamotive | React.js Developer | Warsaw | OnsiteIdeamotive - a dev shop specializing business process automation for startups and growing companies is looking for a React Developer. We are located in Warsaw, Zoliborz at a start-up accelerator mansion called ReactorWarsaw.Our stack consists of Ruby on Rails and/or Node on backend and React on a frontend, usually Postgres as a main database and Redis + Sidekiq for queues.You, as a candidate, should be a computer science graduate (or has equivalen...
onsite Various - Full Stack Engineer, Linux Operations Engineer, IT Systems Engineer, Front-End Customer Success Developer and other roles full-time 314w ago
angularlinux
Show description
SiteSpect | Various - Full Stack Engineer, Linux Operations Engineer, IT Systems Engineer, Front-End Customer Success Developer and other roles | Boston/Newton, MA | ONSITE | https://www.sitespect.comSiteSpect is a digital optimization platform that lets you test or target your web traffic without having to change any code on your side. Under the hood, SiteSpect is a reverse proxy. Requests from end users are routed to an appropriate backend and SiteSpect modifies the response based on what test...
onsite Senior Frontend Engineer, Software Engineer full-time 314w ago
javascripttypescriptpythonreactnodejspostgresqlawskafka
Show description
LineLibrary | Senior Frontend Engineer, Software Engineer | Chicago, IL | Full Time | OnsiteLineLibrary is an early-stage startup whose mission is to create advanced sports betting trading applications. We're on our way to disrupting the sports betting market globally with our disruptive tooling and business model. We have recently closed a seed round led by SeventySix Capital. You'll get equity, competitive pay and benefits, and the opportunity to work/develop with technology usually found in f...
onsite Full Stack Engineer, Frontend Engineer full-time 314w ago
typescriptreactdjangoawscelery
Show description
Truework | Full Stack Engineer, Frontend Engineer | San Francisco, CA | Full time | Onsite | https://www.truework.comTruework is reshaping the way personal information is exchanged online by giving back control to consumers. We are currently handling thousands of deep-identity verifications per month and are growing fast. These transactions are enabling billions of dollars in loans to be approved as well as make sure that the background check is successful.As one of the engineers at Truework, yo...
San Francisco, CA full-time 314w ago
Show description
Bodyport | San Francisco, CA| Multiple roles: software, data, regulatory | Full-time | www.bodyport.comBodyport is a data-driven virtual clinic for the prevention and management of heart disease.Through novel sensors and biomarkers, we provide advanced cardiac monitoring and continuous care in every home.https://bodyport.com/careers
Full Stack Engineer full-time 314w ago
javascriptreactgcpazure
Show description
Striim | Full Stack Engineer | Forward Deployed Engineer| San Francisco, CA | Full-timeAt Striim, we're building a product that helps the world largest companies (banks, retailers, airlines, shipping/logistics) operate mission-critical applications in the cloud.Our core technology is based on database change data capture, in-memory stream processing, and real-time data visualization in React.js.We're a well-funded, post-Series B company with a large roster of Fortune 100 companies as customers. ...
remote Mountain View, CA and REMOTE USA/CANADA full-time 314w ago
python
Show description
Khan Academy | Mountain View, CA and REMOTE USA/CANADA | Senior Backend / Fullstack | https://khanacademy.org/careersWe're a non-profit with a mission to provide a free, world-class education to anyone, anywhere. It's a big mission that we're taking on step by step. While we want anyone to be able to get a great education independently, we've been focusing a lot on trying to help teachers working in their classrooms (and a lot of teachers and parents are using Khan away from their classrooms rig...
onsite NY, NY (NYC) full-time 314w ago
javascriptpythonreactvuedjangoterraformansiblereact-native
Show description
Narmi (Techstars NYC '17)| New York, NY (NYC) | ONSITE | https://www.narmi.comNarmi is helping reinvent banking in the United States. We create a more accessible and useful financial ecosystem by powering the online banking, mobile banking, account opening and open banking APIs for the 10,000 credit unions and community banks in the United States.You'll be working on production software that has a real impact on the average American's life everyday. Our software helps them save money on their bi...
remote NY, NY full-time 314w ago
swiftkotlinexpressiosandroid
Show description
Perry Street Software | New York, NY | Product Manager; Mobile Developer | Remote (WFH) | Full-TimeThe publisher of SCRUFF (www.scruff.com) and Jack'd (www.jackd.com), two of the worlds largest queer dating apps, is hiring for Product Manager and Mobile Developer (iOS or Android). Today we are 100% remote, though normally we run a distributed engineering team (1/2 in NYC, 1/2 remote). Our company connects millions of gay, bi, trans and queer people around the world every day. We also take our re...
remote full-time 314w ago
javascriptjavareactnodejs
Show description
SINCHWe do messaging. We route billions of SMS and other kinds of messages every year.We're a pretty international crowd, and we've helped lots of people relocate and helped with visas and things. We're even open to remote workers.A smattering of our techie jobs:USA:* Head of Platform Integrations | Seattle https://wrkbl.ink/ggljiBJ* Technical Solution Architect | Seattle https://wrkbl.ink/hUONDGM* Growth Marketing Lead | Seattle https://wrkbl.ink/6FrO23g* Service Implementation Specialist (Span...
onsite Berlin full-time 314w ago
elixir
Show description
SumUp | Berlin | (Mid/Senior) Elixir Engineer | Onsite | Visa supportedWe are looking for a backend engineer in the Hardware tribe to help us maintain and improve our devices. Our mPOS and printers delegate a significant part of the payment logic to the backend, giving us the flexibility and development speed which our merchants require from us. As a backend engineer, you will support our team with delivering new features to one of those devices and maintaining existing ones - transaction flows ...
onsite Senior Android Engineer, Software Engineer, Solutions Engineer full-time 314w ago
android
Show description
JW Player | Senior Android Engineer, Software Engineer, Solutions Engineer | New York (NYC), NY and California | ONSITE | Full-timeJW Player pioneered video on the web over a decade ago and continues to innovate as the world’s largest network-independent platform for video delivery and intelligence. Media companies including Fox, VICE, Business Insider, and Univision, in addition to hundreds of thousands of creators of all types and sizes, rely on JW Player to deliver and monetize their content ...
San Francisco full-time 314w ago
ios
Show description
Superhuman | San FranciscoHelp us build the fastest email client in the world!iOS / Backend / Fullstack roles all available: https://superhuman.com/jobs
remote full-time 314w ago
rails
Show description
looking for a remote rails developer who does devops to work on the backend/api/infrastructure, must be able to work in US hours.
https://getcloudapp.com
We have lots of customers and growing fast. My contact info is in my profile.
onsite San Francisco, CA and Denver, CO full-time 314w ago
rubyreactrailsreact-native
Show description
Alto Pharmacy | San Francisco, CA and Denver, CO | Software Engineer | Full Time - Onsite | https://www.alto.comAt Alto we are using technology to re-design and re-build the pharmacy from the ground up to offer better patient care and improve people's lives. We recently announced our series D funding and our plans to expand nationwide. (https://markets.businessinsider.com/news/stocks/alto-pharmac...)We believe that the status quo in the pharmacy industry is broken and we’re doing something about...
remote www.canonical.com full-time 314w ago
linux
Show description
Canonical | www.canonical.com | Remote (work from home) | Full Time | Engineer, Project Manager, Design/UX, ProductCanonical and Ubuntu are at the forefront of cloud and IoT computing, helping customers master the challenge of operations on hybrid cloud, bare metal, and container-based systems.We’re recruiting people that love Linux, automation, operations, and are interested in cracking some of the world’s toughest problems at scale, with a twist: we’re bringing the scale economics and flexible...
onsite Embedded/Backend/App Software Engineers, Architects, Product Owners, DevOps, various roles full-time 314w ago
awsjenkinsgitlablinux
Show description
MBition | Embedded/Backend/App Software Engineers, Architects, Product Owners, DevOps, various roles | Berlin & Stuttgart, Germany | Full-time | ONSITE (mobile office possible and currently used by everyone due to COVID-19), REMOTE for special cases possibleMBition is a 100% subsidiary of Mercedes-Benz RD. Traditionally focussing on infotainment software (in-car, smartphone apps, cloud backend), we are extending our focus to other domains in the car gradually, e.g. ADAS (advanced driver-assistan...
onsite Full Stack and System Engineers full-time 314w ago
javareactawsapache
Show description
Dremio | Full Stack and System Engineers | Santa Clara, CA | Onsite (once shelter-in-place ends) | https://www.dremio.com/We are looking for Full Stack and System engineers. Our stack is Java and React and open source our core technologies (such as Apache Arrow).Dremio is the Data Lake Engine company. Our mission is to reshape the world of analytics to deliver on the promise of data with a fundamentally new architecture, purpose-built for the exploding trend towards cloud data lake storage such ...
onsite ONSITE (WFH for now) full-time 314w ago
pythonreactdjango
Show description
Carta (formerly eShares) | ONSITE (WFH for now) | Full-time | https://carta.com | NYC - New York, NYCarta is building the network graph of asset ownership. We help 10k+ privately held companies and a growing number of public companies track who owns what. We're a series E company and offer very competitive benefits packages (equity, free lunch, 401K, fully subsidized personal healthcare, transportation and cell phone allowances, etc).
Specifically, the Enterprise team creates products to satisfy...
onsite Redwood City, CA full-time 314w ago
typescriptpython
Show description
Skydio | Redwood City, CA | Full-Time | Platform / Backend / Web / Infrastructure / DevOps Software Engineers | ONSITE (wfh for now)We are hiring (3 yrs min experience) engineers for the Platform Software team I lead at Skydio (we build self-flying camera drones, our second product, Skydio 2, sold out in a few hours last October: https://www.youtube.com/watch?v=imt2qZ7uw1s )Our team owns a wide variety of systems, including cloud and web software (APIs for flight and telemetry data, complex SPAs...
onsite engineers full-time 314w ago
machine-learning
Show description
comma.ai | engineers | San Diego | onsite | full-timeWe have an open source driving agent: https://github.com/commaai/openpilotUnlike most other companies in the self driving car space, we are profitable and have 1000s of daily active users. Search "openpilot" on YouTube to see some of them.We're looking for a software engineer to develop openpilot, an ML Engineer / Data Scientist, a Safety Engineer, an Infrastructure Engineer, and a Navigation Designer. Head to https://comma.ai/jobs for more in...
onsite Amsterdam, Netherlands full-time 314w ago
Show description
MessageBird (YC S16) | Amsterdam, Netherlands | ONSITE (usually, not currently) | Full Time | https://messagebird.comMessageBird is a Y Combinator backed communications platform for SMS, Voice and Chat. Serving 15,000 customers globally, we connect businesses to 7 billion phones worldwide. Our purpose lies in revolutionising the way the world communicates.What we’ve achieved so far has only been made possible through our talented team of over 40 nationalities. With offices in Amsterdam, Singapor...
onsite Team Lead full-time 314w ago
javaspringawsandroid
Show description
ChargeLab | Team Lead | Toronto, ON | ONSITE (WFH for now) | FULL-TIMEChargeLab (https://www.chargelab.co/) is the Android of EV charging: we make hardware-agnostic software for managing networks of EV chargers. I'm the founder & CEO.We're hiring a team lead to manage and scale up our existing team of 7 developers (local & remote). You should be full-stack but most comfortable with back-end (Spring Boot, Java, Hibernate, jOOQ, AWS).Competitive salary + 1–5% equity.We interviewed with YC in Mount...
USD 110k-140k/yr onsite San Francisco, CA; Atlanta, GA full-time 314w ago
pythonreactdjangodockerkubernetes
Show description
Fold | San Francisco, CA; Atlanta, GA | Software Engineer | ONSITE & REMOTE | Full-time | $110k-140k with equity We are a cryptocurrency company backed by a number of well-known investors in the space.
We have opportunities across our flagship payment product, Fold [0] [1], working with Bitcoin Lightning Network technologies and working to get bitcoin in the hands of everyday people. We’d love to hear from any Docker + Kubernetes, Django, or React/Native experts out there.Crypto, Python, or Kube...
onsite Front-End Engineer + Embedded Software Engineer + Flight Operations Manager full-time 314w ago
Show description
Sevendof | Front-End Engineer + Embedded Software Engineer + Flight Operations Manager | Trondheim, Norway | ONSITE, VISA, Full-time | https://www.sevendof.com/Sevendof is a startup focused on building the drone infrastructure of the future. We seek to make drones available as a service to businesses for purposes such as inspection, mapping, and search and rescue. Sevendof will operate a network of long-range drones which are stationed in the field, enabling missions to be carried out automatica...
onsite Engineer, Designer, Sales, Marketing, PM, Support full-time 314w ago
Show description
Notion | Engineer, Designer, Sales, Marketing, PM, Support | SF | https://www.notion.so | Full-time Onsite== Intro ====================================Hey there, Notion founder here. At Notion, our goal to create the general purpose work tool for a post-file, post-MS Office world. My cofounder and I often joke that this was like the "hot startup topic" of the 90s. Unfortunately, tools for knowledge workers haven't advanced much since then. The state of art is either Google Docs/Quip/Dropbox Pape...
remote San Francisco, CA full-time 314w ago
Show description
Doximity | San Francisco, CA | Full Time | REMOTE | Multiple RolesWe develop products to connect health care providers and keep them informed of the latest developments in the medical world.One of our products that's gotten a lot of attention during the current pandemic is Dialer[0]. It allows providers to display their office number in the caller id when contacting patients from their own device, preventing their personal number from being shared without having to block it.We're hiring for many...
NYC full-time 314w ago
reactawskubernetesterraformansiblereact-nativeselenium
Show description
Yieldstreet | NYC | Senior Software Engineer (Frontend, Mobile); Senior Test Engineer; DevOps EngineerWe're building the world's most robust alternative investment platform that's disrupting the old-school wealth management industry. We believe that by using cutting-edge technology and data-driven decisions, we can close the gap and democratize wealth. We're scaling quickly - we've raised $178M in funding to-date, and we've partnered up with BlackRock and Citi to help bring alternative investmen...
onsite London, United Kingdom full-time 314w ago
javascriptpythongo
Show description
Cytora | London, United Kingdom | Full Time | ONSITE (WFH currently due to covid) | Golang, JavaScript and Python | https://cytora.comI'm the CTO at Cytora, a small and experienced B2B product team laser focused on bringing technology to transform the commercial insurance industry.Using our API platform, insurers can underwrite more accurately and efficiently, and deliver fairer prices to their customers.Our engineering team are proud to be one of the best places to build data products in Go, de...
onsite Full-Stack Software Engineers full-time 314w ago
Show description
Qualia | Full-Stack Software Engineers | San Francisco, CA | Onsite (remote during shelter-in-place) | Full-time, Salary + Options
Qualia (qualia.com) is a startup making web applications for real estate professionals. We just raised our series C and we're growing! We're looking for full-stack software engineers at all levels.Our engineering culture is collaborative and friendly, and we make beautiful products that our customers love to use. We're looking for engineers who want to be generalists...
onsite Full Stack and Backend Engineers full-time 314w ago
typescriptrustrubyreactrailspostgresqlredisinfluxdb +4
Show description
OneSignal | Full Stack and Backend Engineers | San Mateo, CA | Onsite | https://onesignal.comOneSignal helps developers simply implement re-engagement messages in their applications and websites, and we do it by taking care of a lot of the complexity on our side.Each day we deliver over 6 billion daily notifications (4x more than the number of emails SendGrid sent on their IPO), for nearly 1 million registered developers (More than Twilio on their IPO).We've observed a 10% to 20% increase in usa...
remote Product Engineer full-time 314w ago
typescriptreactnodejsgraphql
Show description
ObieCRE (YC S19) | Product Engineer | Chicago | Full-time | REMOTE currently, ideally ONSITE eventuallyWe're looking for engineer #4 to help build our product, our team, and our company. A small pivot has led to great product-market fit, and we now have acres of green field that need coding.How we make money: If you own a building that leases to office or commercial tenants, you need insurance. This is true if the economy is growing or crumbling. And as a result of this mandatory nature, it has ...
onsite DevOps Engineer (+ More) full-time 314w ago
juliamachine-learning
Show description
The Julia Lab (MIT) | DevOps Engineer (+ More) | Onsite or Remote | Full Time | https://julia.mit.edu/The Julia Lab is a lab in MIT's CSAIL which focuses on the development of software tooling for solving large-scale scientific problems. Named after it's original result, the Julia programming language, the Julia Lab's research ranges from scientific machine learning (SciML) [1] and differentiable programming [2] to large-scale heterogeneous parallel computing [3]. The lab is currently growing in...
onsite Bangalore, India full-time 314w ago
Show description
HackerRank | Bangalore, India | Fulltime | Senior/Lead Devops Engineer, Lead SDET, Lead Backend Engineers | ONSITE | www.hackerrank.comHackerRank is a Y Combinator alumnus backed by tier one Silicon Valley VCs. We are a skills-based hiring platform that helps companies evaluate technical skills, better. We’re driving a new paradigm shift by eliminating resumes and creating opportunities for hundreds of thousands of programmers worldwide. We have a community of 5M+ developers and 1,000+ customers...
Senior Software Engineers (Full-stack, Backend, Frontend) & Data Engineers full-time 314w ago
elixirreactpostgresqlawsdockerterraformgraphql
Show description
Validere (YC S16) | Senior Software Engineers (Full-stack, Backend, Frontend) & Data Engineers | Toronto, ON | Full timeHarvard born and Y-Combinator backed, we’re on a mission to transform the global energy industry. Our team comes from different places and brings different talents to the table, but we’re all here for the same reason: to solve complex challenges and make a profound impact with some of the brightest and kindest people we know.We are looking for both React and Elixir (or those in...
remote REMOTE full-time 314w ago
javascriptc#vueaspnet
Show description
TestDome | REMOTE | Full Time | Frontend Developer (Vue.js + ASP.NET Core) | https://www.testdome.comAt TestDome, we make it easy for companies to screen job applicants with work-sample tests. We are fully remote with a small and dedicated team based around the world. Some of our customers include eBay, PayPal, and Turkish Airlines.We are hiring an experienced frontend developer with some full stack experience. You will help transition our web app to modern best-practices. Salary up to $60k/year...
onsite Lead (React+Java), Fullstack, Backend (Java), Frontend (React), DevOps full-time 314w ago
javareact
Show description
Quatico.com |Lead (React+Java), Fullstack, Backend (Java), Frontend (React), DevOps | Zurich, Switzerland | SALARY: 90k-130k CHF | ONSITE | Swiss or EU member-states passport-holders onlyWe currently are looking to hire one fullstack (React, Java) senior engineer, or team lead. We have a "engineering over management" culture where you find engineers both with formal computer science background and also ones, who are self-taught. Our CTO worked with Erich Gamma et al before.We are building tailor...
onsite Multiple Positions full-time 314w ago
machine-learning
Show description
Testim.io| Multiple Positions| SF, CA / Tel Aviv | Full-time | ONSITE and Remote (dev jobs are mostly on site) | https://testim.ioTestim.io is hiring fullstack developers, devops engineers, sales engineers and for a bunch of other ( Testim.io ).We are a well funded startup based in SF, Tel Aviv and several other locations working on making E2E automation fun. We use AI/ML to create stable tests and to stabilize them the more they run. You will be working with talented engineers and open source c...
remote Content Strategy / Marketing / Creator full-time 314w ago
Show description
IPinfo.io | Content Strategy / Marketing / Creator | Remote | Part or Full timeIPinfo is an IP address information API and data provider. Our industry leading IP geolocation API handles over 20 billion API requests a month. We're bootstrapped, profitable, and growing. We have a small fully distributed team spread across the globe, and we’re working on lots of exciting things!We're looking for an exceptional and ambitious person to join our team and head up our content efforts - coming up with cl...
onsite Software Developer - New Grad full-time 314w ago
javascripttypescriptc#reactaspnetsqlserver
Show description
RepSpark | Software Developer - New Grad | Irvine, CA | Full-time | ONSITE (currently remote) | https://www.repspark.comRepSpark is a B2B e-commerce platform that provides one simple online platform for retail buyers to place wholesale orders and gives sales professionals the tools they need to sell intelligently.Our stack includes C#, ASP.NET, SQL Server, TypeScript, and React (https://stackshare.io/repspark/repspark).Essential duties and responsibilities:- Supporting our Customer Success team ...
remote https://www.crazygames.com/ full-time 314w ago
Show description
CrazyGames | https://www.crazygames.com/ | Leuven, Belgium | REMOTE Product Engineer
With recent technologies such as WebGL and WebAssembly, the browser has become a powerful gaming platform. High-quality 3D graphics and near-native level performance are becoming possible without the need for downloads, apps, or platform-specific development. We are building the tools to allow game developers to use this opportunity.Our browser games platform is already reaching more than 15 million people per m...
remote full-time 314w ago
machine-learning
Show description
My group at MUFG Americas and UnionBank is looking for modern broadly skilled and security-minded engineers.REMOTE is fine in certain hub areas such as NYC, SF, LA, Charlotte, Tempe, Dallas, etc., where you'd be able to attend team meetings in person from time to time (most teams prefer at least weekly) after location-based work restarts.Excerpt from my profile here:We are building a platform supporting the pace of evolution of financial technology, to unlock new businesses and exceed commercial...
remote Ann Arbor MI, Austin TX, Remote full-time 314w ago
pythonawsdockeransibleiosandroid
Show description
Duo Security | Ann Arbor MI, Austin TX, Remote | Full timeDuo is not slowing down its hiring during all of this. With our focus on MFA and Zero Trust / Beyond Corp, our products are positioned to help companies transition to remote. We were recently acquired by Cisco who was named a leader in the "2019 Forrester Zero Trust Platform Wave".I'm working in DevOps where our stack includes Python, Docker, Ansible, and AWS. I know our backend is written in Python. We also have iOS, Android, and Windows...
remote Engineers and Data Scientists full-time 314w ago
machine-learning
Show description
McKinsey & Company | Engineers and Data Scientists | NYC, Bay Area, Atlanta, Waltham | Full-time | Remote for nowMy team at McKinsey & Company builds software tools for some of the biggest financial services firms in the world. We also do digital business building in real estate and other industries, as well as machine learning to solve real world challenges.We are hiring folks who want to work on interesting problems, in a professional environment.Your skills: application development, data pipe...
remote Full Time full-time 314w ago
javascriptpythonrubyscalareactvuerailspostgresql +4
Show description
Sequoia Capital | Full Time | Platform Engineer | https://www.sequoiacap.comWe're growing our technology team to shape the future of investing. Hiring right now for a Platform Engineer, an Application Engineer, and a Security Analyst. Our stack includes Ruby on Rails, Python, Javascript (Vue, React), Postgres, Spark/Scala, Nginx, AWS & Heroku. More info here: https://share.getcloudapp.com/NQuZBdP2Menlo Park preferred. REMOTE can be considered as well.Please email me if you are interested in any ...
remote DevOps Engineer full-time 314w ago
javascriptpythonvuemysqlawsapacheairflow
Show description
The Pacific Financial Group | DevOps Engineer | REMOTE (US based) | Full Time | tpfg.comThe Pacific Financial Group Inc. (‘TPFG’) is an innovative, fast growing investment advisory and WealthTech company with $3 Billion in assets under management.My remote team is adding a new DevOps engineer to rapidly expand the delivery of our new enterprise risk assessment and monitoring platform for financial advisors. This is a great opportunity for a mid-level engineer looking to gain experience from our ...
onsite Senior Full Stack & Front end Engineers full-time 314w ago
typescriptreactnodejsmysqlgcpreact-native
Show description
Dave.com | Senior Full Stack & Front end Engineers | Los Angeles, CA | "Onsite" only, relocation available | Full timeDave.com is building products banks won't to improve our customers' financial lives. We've built a mobile app that predicts your "lowest balance until payday" and offers a zero-interest paycheck advance as an alternative to paying an overdraft fee. As the job market is disintegrating around us, Dave is uniquely positioned to help our customers manage their finances and avert fina...
EUR 50-150/yr Software engineer(s) + Operations and Finance full-time 314w ago
javascriptpython
Show description
Secfi | Software engineer(s) + Operations and Finance | Amsterdam, the Netherlands + San Francisco | EUR 50-150k + equity
Secfi is a VC-backed fintech start-up that helps start-ups and employees better manage equity compensation. We do this by providing shareholders of private companies with liquidity so that they can exercise their options or access capital for personal use. We build technology products that help private company employees make the most of their equity and make more informed dec...
onsite Senior Product Manager full-time 314w ago
Show description
Boulder Care | Senior Product Manager | Portland OR | Full-time onsite (WFH currently due to covid) | https://boulder.careCome work for Boulder Care!Boulder Care is a digital health platform for treating opioid addiction. We are a well-funded VC-backed company with the opportunity to build a massive business. Our healthcare system spends billions of dollars combating the opioid epidemic.Opioid overdose is the leading cause of death for Americans under 50, but fewer than 10% of patients who need ...
remote REMOTE full-time 314w ago
Show description
Mixin | REMOTE | Full Timehttps://github.com/MixinNetworkSecure digital assets and messages on MixinWe build open source software that always put security, privacy and decentralization at first.
onsite San Francisco & Seattle full-time 314w ago
typescriptrustreact
Show description
ngrok | San Francisco & Seattle | ONSITE | Full-time | https://ngrok.com/I'm the Director of Engineering here at ngrok.Ngrok builds developer tools and infrastructure to bring secure, powerful network tunnels to individual developers and companies alike. Ngrok's tools enable our customers to easily share local development environments, securely access remote devices, build and test webhook integrations, and much more.We're looking for Backend & Devops Engineers across a number of different teams...
remote St Paul, MN, USA full-time 314w ago
linux
Show description
CodeWeavers | St Paul, MN, USA | Full Time | REMOTE | Wine, 3D Graphics, and General Open Source Developers | C-language systems programminghttps://www.codeweavers.com/about/jobsCodeWeavers is hiring skilled C programmers to work on the open source Wine project and other related open source projects, including several 3D graphics projects (Vulkan, OpenGL, and Direct3D). CodeWeavers partnered with Valve Software to integrate Wine into the Steam for Linux client as a part of the Steam Play (Proton...
full-time 314w ago
Show description
Let's Support the Country: Who’s Hiring In The Coronavirus Economy.Zoom, 2,400-person video conferencing company has 235 open roles in sales, support, marketing, HR, Finance, engineeringhttps://www.forbes.com/sites/alexandrasternlicht/2020/03/20/...Amazon is hiring 100,000 workers, Walmart is hiring 150,000 — here are the sectors adding jobs amid coronavirushttps://www.marketwatch.com/story/amazon-is-hiring-100000-wo...Domino's hiring 10,000 employees amid coronavirus demand surgehttps://www.fox...
USD 75k-158k/yr remote United States full-time Unknown
Show description
Job Title: eLearning TrainerJob Category: Information TechnologyTime Type: Full timeMinimum Clearance Required to Start: NoneEmployee Type: RegularPercentage of Travel Required: NoneType of Travel: None* * *The Opportunity: The eLearning Trainer is responsible for designing, developing, and delivering engaging digital learning experiences that support organizational training initiatives.